[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56840.1"

            "dihydropteroate synthase"
            ""

OrgPattern -------1---------111111-32222222-----------1111111111--1--1111111-11 1222333333323232222-2222222222123222233332222222322322223211224223323332---222111121222222111222---1211222222211111111111111222222222122---112222222222212211121112222221141111111-112122122222222222222222222222222222222222222222222222222222222222221222222--2--22-2-2222--2--2--2222222222222222222222222222222222222222221222212-222222222-2-22222222--2-22--21222222--222222222-212222-----222222222222222222222222-22222222222-22222222222222222211111111222222222222222221112122211----11--1----1-1-1-111121222212222222222222222222222222222-2222112222222222222222122222222222222-22222212222222222222222111122321211211111121221222221222122321232222222222222222222222222-22222------22222222222222332-222233222222322222242222232222224223223222322222323212222222222222222222222222232223222222232222224233522222222232222222222222211111111123222222322222222222222222222221-222222-----------1-2----------------------22-2222222321 11--11--1---11111111111111111111111111111111111111111111111111111111111111111-1111111111-12111121111121111-13------------------------------------------------------1------3----112161111121231211131111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGE:Sequence :EEEEEcccEEEccccEEEEEEEcccccTTTTTTTHHHHHHHHHHHHHTTcccEEEEEEcc:Sec Str : ################ :PROS|17->32|PS00792|DHPS_1|PDOC00630| : ##########:PROS|51->64|PS00793|DHPS_2|PDOC00630| : ==============================================:RP:SCP|15->267|1ad1A|5e-74|42.3|246/264|c.1.21.1 : ==================================================:BL:SWS|11->266|DHPS_SHIFL|3e-62|48.2|255/282 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->224|PF00809|3e-56|59.0|205/208|Pterin_bind 61: . . . * . .: 120 :STRPGAAPVSVDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFR:Sequence :cccTTcccccHHHHHHHHHHHHHHHHHcGEEEEEEcccHHHHHHHHHTTccEEEETTTTc:Sec Str :#### :PROS|51->64|PS00793|DHPS_2|PDOC00630| :============================================================:RP:SCP|15->267|1ad1A|5e-74|42.3|246/264|c.1.21.1 :============================================================:BL:SWS|11->266|DHPS_SHIFL|3e-62|48.2|255/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->224|PF00809|3e-56|59.0|205/208|Pterin_bind 121: . . + . . .: 180 :DPAMVDAVRDSDCGLVVMHMQGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDR:Sequence :cTTHHHHHTcTTcEEEEEcccccTTTGGGccccccHHHHHHHHHHHHHHHHHHTTccGGG:Sec Str :============================================================:RP:SCP|15->267|1ad1A|5e-74|42.3|246/264|c.1.21.1 :============================================================:BL:SWS|11->266|DHPS_SHIFL|3e-62|48.2|255/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->224|PF00809|3e-56|59.0|205/208|Pterin_bind 181: . * . . . .: 240 :ICIDPGPGFGKTPSQTLELVRNFQEFVRLGYPVMVAVSRKSFLGWAYGIDEPSARDEVSA:Sequence :EEEEccTTccccHHHHHHHHHTHHHHTTEEEEcEEccTTcHHHHHHHTcccGGGGHHHHH:Sec Str :============================================================:RP:SCP|15->267|1ad1A|5e-74|42.3|246/264|c.1.21.1 :============================================================:BL:SWS|11->266|DHPS_SHIFL|3e-62|48.2|255/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|20->224|PF00809|3e-56|59.0|205/208|Pterin_bind 241: + . . . . *: 300 :AEALMACELGASVVRAHNVAATVAALEGLRPYALIGMGCNVPLVASPGEEREGKIAMLNQ:Sequence :HHHHHHHHTTccEEEEccHHHHHHHHHHTcccEEEEEEEccccccccHccHHcHHHHHHH:Sec Str :=========================== :RP:SCP|15->267|1ad1A|5e-74|42.3|246/264|c.1.21.1 : ============================:RP:SCP|273->423|1cbkA|6e-36|38.3|141/160|d.58.30.1 :========================== :BL:SWS|11->266|DHPS_SHIFL|3e-62|48.2|255/282 : ===:BL:SWS|298->410|HPPK_BACSU|6e-22|44.2|113/167 : $$$$$:RP:PFM|296->410|PF01288|3e-23|50.0|114/126|HPPK 301: . . . . + .: 360 :AITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELLGYLHAVENSL:Sequence :HHHHHHHcTTEEEEEEccEEEEcccccTTcccEEEEEEEEEEcccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|273->423|1cbkA|6e-36|38.3|141/160|d.58.30.1 :============================================================:BL:SWS|298->410|HPPK_BACSU|6e-22|44.2|113/167 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|296->410|PF01288|3e-23|50.0|114/126|HPPK 361: . . . * . .: 420 :GRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHVLANDV:Sequence :TTccccccEEEEEEEEcTTcccccEEccccEEccTTGGGcHHHHHHHTTTccTTccTTcc:Sec Str : ############ :PROS|367->378|PS00794|HPPK|PDOC00631| :============================================================:RP:SCP|273->423|1cbkA|6e-36|38.3|141/160|d.58.30.1 :================================================== :BL:SWS|298->410|HPPK_BACSU|6e-22|44.2|113/167 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|296->410|PF01288|3e-23|50.0|114/126|HPPK 421: . . + . . .: 480 :PVSVDGVTVGKSVRL :Sequence :cHH :Sec Str :=== :RP:SCP|273->423|1cbkA|6e-36|38.3|141/160|d.58.30.1