[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56911.1"

            "xanthine phosphoribosyltransferase"
            ""

OrgPattern -------------------------------------1----1------1-----1111-1------- -----------------------------------------------------------------------1111111--11------1111-111----------------------------------------111--------------------------------------------111------122222222222222222222222221122122222222242222222222222212111112122222222222222221111111222222221122222222222222222222222221111-111112111222222212122--133311111-111-11-1--11-11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111---1-11111111111111111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------21----------------------------------------------------------------------------------11----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEAS:Sequence :HHHHHHHcEEEETcccTTcEEEEETHHHHTcHHHHHHHHHHHHHHHTTTTccEEEEEccT:Sec Str : ===========================================================:RP:SCP|2->190|1y0bA1|2e-59|51.3|187/191|c.61.1.1 :============================================================:BL:SWS|1->191|XPT_CLOPH|5e-74|70.2|191/194 61: . . . * . .: 120 :GIGIACVVARHFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHV:Sequence :THHHHHHHHHHHTcEEEEEccTTcccEcccccEEEEEEEETTEEEEEEEEGGGccTTcEE:Sec Str :============================================================:RP:SCP|2->190|1y0bA1|2e-59|51.3|187/191|c.61.1.1 :============================================================:BL:SWS|1->191|XPT_CLOPH|5e-74|70.2|191/194 121: . . + . . .: 180 :LIIDDFLANGCALNGLIELVGEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVER:Sequence :EEEEEEEcccHHHHHHHHHHHHTTcEEEEEEEEEEEGGGcHHHHHHTTTcEEEEEEcccE:Sec Str :============================================================:RP:SCP|2->190|1y0bA1|2e-59|51.3|187/191|c.61.1.1 :============================================================:BL:SWS|1->191|XPT_CLOPH|5e-74|70.2|191/194 181: . * . . . .: 240 :MDPETGEIAFR :Sequence :EEEEcHHHEE :Sec Str :========== :RP:SCP|2->190|1y0bA1|2e-59|51.3|187/191|c.61.1.1 :=========== :BL:SWS|1->191|XPT_CLOPH|5e-74|70.2|191/194