[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "elen0:ACV56973.1"

            "4Fe-4S ferredoxin iron-sulfur binding domain protein"
            ""

OrgPattern 22121322344333325-5574473113-1131-433333233-1--13-21212115253---4--- -7911-11111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6cS334222---------1111--1-11111---------------2243333332344411333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------134-21111111-1-1411-111--1--9--13pl3354-4AB11131--1831--1------21--423-32--11111111112-2242232511----------1-1121-11212-1--31211111111311--7-2-------------------------------111-122-3211212233333323444413222334211232241443325213124-1-23----------B3418D558CC7DAAAF189797693-BABA353827422112211-2-------2B3321174-111-----45886-5H9A9787BA8J8---1842------C6D9AA-HIIGHGFFHH-HHGIHGGHGHIGHFHHHHAAAA9621CHFGGHHHHHHGFHFGG7ACBFEFG--555555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------21--11111131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYF:Sequence :cccEEEEEccGGGGccccccccTTcccTTcccHHHHHccccccccccccccHHHHHHHEE:Sec Str :============================================================:RP:SCP|1->152|1ti2B2|1e-43|31.8|151/195|d.58.1.5 : =========================================================:BL:SWS|4->155|PHSB_SALTY|1e-35|46.3|147/192 61: . . . * . .: 120 :LPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERV:Sequence :cccTTTTccccccTTTcTTccEEEEccccEEEcTTTccccccHHHHcGGGccEETTTccH:Sec Str : ############ :PROS|97->108|PS00198|4FE4S_FER_1|PDOC00176| :============================================================:RP:SCP|1->152|1ti2B2|1e-43|31.8|151/195|d.58.1.5 :============================================================:BL:SWS|4->155|PHSB_SALTY|1e-35|46.3|147/192 121: . . + . . .: 180 :VEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPDSPGCQYEEMTQTR:Sequence :HHHHHHHHHHHHTTccccccccccccTTHHHcccTTGGGHHHHHTTTcHHHHHHHHcc c:Sec Str :================================ :RP:SCP|1->152|1ti2B2|1e-43|31.8|151/195|d.58.1.5 :=================================== :BL:SWS|4->155|PHSB_SALTY|1e-35|46.3|147/192 181: . * . . . .: 240 :VKLKDYVEPYTENDIHHLADVGNEPKLMYLMREGRKWRE :Sequence :E EcccT TccccccEEEEccccTT :Sec Str