[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACV56973.1 elen0 ACV56973.1 "4Fe-4S ferredoxin iron-sulfur binding domain protein"
MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYF
LPVQCQHCENPECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERV
VEKCTLCEQRISQGELPQCVAQCGARARFFGDLDQGVDNFEGPAHPDSPGCQYEEMTQTR
VKLKDYVEPYTENDIHHLADVGNEPKLMYLMREGRKWRE
//