[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30153.1"

            "outer membrane lipoprotein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------1-------------------------------------------------------------11--1---1--1-------------------------------------------------------------------------------------------------------------------------------------1----------------------1111-11111111111111111111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFRPITKNLCLLIAAFSLSACGIIQPYTAPVPQGKEIKDKKLFEIKPNMTKSEVTYILGS:Sequence : ccccccc EcccccccccccHHHHHHccTTccHHHHHHHHcc:Sec Str : ========================================:BL:SWS|21->111|OMLA_PSEAE|5e-11|29.2|89/176 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->98|PF04355|3e-05|30.0|60/71|SmpA_OmlA 61: . . . * . .: 120 :PDIIDTFNPNQYVYINTYKRNMQDTQFSESKLILTFNNQDRLIGISGNYAPPTKDPVF :Sequence :ccEEEEEccccEEEEEEEEccccccccTTcEEEEEEETcTEEEEEEEEccc :Sec Str :=================================================== :BL:SWS|21->111|OMLA_PSEAE|5e-11|29.2|89/176 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|37->98|PF04355|3e-05|30.0|60/71|SmpA_OmlA