[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30160.1"

            "riboflavin biosynthesis protein ribAB"
            ""

OrgPattern --------111111----1--1-21-11-11111111111111121-1111111-1-111-211--11 2221311111121111122-2111212222222111216511112-111111-322122222312234311----1-----12111111212-111---2121111112111111111111111111121111121222-111111111111211111111111111111111111111111111111---1111111121311112111111311111112211------1311111111111111111111--1----2---1111----111-111111-------11111111111-----------------------11-11222211311111111111-111--1111111211211111-1-11111-111111112111111111111-1111111111-11211211111112211212221122111223222222211111111211112232222222222---------------222212443222222344335344443333444424444444311222411221111112211213312222222111211122121222222221212311122332324113222222222222222222222222223342223123233333233333333333332-1111122-22222222222222222222-2222222222222222222222223322222222222222222222222222222222222232222221111111112133111132212222122233333332223222224333344442333111111111122243333354344222222222222221111111111----------1----------------1--------11-111-111111 ------1-----2222223222222222222222222222222222222222222222222222222222222222222222222222-23222222222242232-25-------------------------------------------------1----1-----------1222N2212213462332254331 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFEQIKNNVENAIEALKQGKPVVVLDDYDRENEGDLILPGQKATEENIAFMLEHTSGIIC:Sequence : cHHHHHHHHHHTcccEEEEccccccccccccccTTcccHHHHHHHHHHcccccE:Sec Str : ======================================================:RP:SCP|7->208|1g57A|2e-81|54.6|196/205|d.115.1.2 : ======================================================:BL:SWS|7->389|RIBBA_THEPX|9e-94|46.3|378/396 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->204|PF00926|4e-59|54.6|194/194|DHBP_synthase 61: . . . * . .: 120 :LAMDSKKARELNLTPMVAADQNNSTFTTPFTVTIEAKEGVTTGVSAKDRAHTIQVASKAD:Sequence :EEEcHHHHHHTTccccccccccTTccccccccccccTTTccccccTTHHHHHHHHHTccc:Sec Str :============================================================:RP:SCP|7->208|1g57A|2e-81|54.6|196/205|d.115.1.2 :============================================================:BL:SWS|7->389|RIBBA_THEPX|9e-94|46.3|378/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->204|PF00926|4e-59|54.6|194/194|DHBP_synthase 121: . . + . . .: 180 :AKTEELARPGHIFPLIANDKGVLGRNGHTEATVDLMKLSGFNSAGVLCELMNKDGTMMKA:Sequence :ccccccccccccEEEEcccccTTccccccHHHHHHHHTTTccccccccccccTTcccccH:Sec Str :============================================================:RP:SCP|7->208|1g57A|2e-81|54.6|196/205|d.115.1.2 :============================================================:BL:SWS|7->389|RIBBA_THEPX|9e-94|46.3|378/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->204|PF00926|4e-59|54.6|194/194|DHBP_synthase 181: . * . . . .: 240 :AELEAFAKKHDLPLLTIAELYQYRLATEIFVTKMASSTIPFKKIGELEMSVYKDNFSGDE:Sequence :HHHHHHHHHHHcEEEEcHHHHHHHHHHH EEEEEEEEEEET TEEEEEEEEEETTTccE:Sec Str :============================ :RP:SCP|7->208|1g57A|2e-81|54.6|196/205|d.115.1.2 : ==============================:RP:SCP|211->371|2bz0A1|1e-44|39.6|154/168|c.144.1.1 :============================================================:BL:SWS|7->389|RIBBA_THEPX|9e-94|46.3|378/396 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->204|PF00926|4e-59|54.6|194/194|DHBP_synthase : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|213->371|PF00925|3e-40|51.6|157/169|GTP_cyclohydro2 241: + . . . . *: 300 :VVVLSKPYSGNNPLVRMHSSCMTGDIFGSLRCDCQDQLHKGIEMISEEGGFFIYLDQEGR:Sequence :EEEEEEccccccEEEEEEEccHHHHTcccccccHHHHHHHHHHHHHHHTcEEEEEccTTT:Sec Str :============================================================:RP:SCP|211->371|2bz0A1|1e-44|39.6|154/168|c.144.1.1 :============================================================:BL:SWS|7->389|RIBBA_THEPX|9e-94|46.3|378/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|213->371|PF00925|3e-40|51.6|157/169|GTP_cyclohydro2 301: . . . . + .: 360 :GIGLTNKLKAYNLQMNENMDTLEANLALGLPADARKYDLAIQVLKYNNVNRCRLISNNPE:Sequence :TTcHHHHHHHHHHHTTTcccHTcccTTcccccccccTHHHHHHHHHTTcccEEEEcccHH:Sec Str :============================================================:RP:SCP|211->371|2bz0A1|1e-44|39.6|154/168|c.144.1.1 :============================================================:BL:SWS|7->389|RIBBA_THEPX|9e-94|46.3|378/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|213->371|PF00925|3e-40|51.6|157/169|GTP_cyclohydro2 361: . . . * . .: 420 :KLAALRNVDIETQPVYCEAFVNSHNRNYLITKKIKAKHTIKGI :Sequence :HHHHHHHTTcc :Sec Str : XXXXXXXXXXXXX :SEG|390->402|itkkikakhtikg :=========== :RP:SCP|211->371|2bz0A1|1e-44|39.6|154/168|c.144.1.1 :============================= :BL:SWS|7->389|RIBBA_THEPX|9e-94|46.3|378/396 :$$$$$$$$$$$ :RP:PFM|213->371|PF00925|3e-40|51.6|157/169|GTP_cyclohydro2