[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30160.1 ftul2 ACD30160.1 "riboflavin biosynthesis protein ribAB"
MFEQIKNNVENAIEALKQGKPVVVLDDYDRENEGDLILPGQKATEENIAFMLEHTSGIIC
LAMDSKKARELNLTPMVAADQNNSTFTTPFTVTIEAKEGVTTGVSAKDRAHTIQVASKAD
AKTEELARPGHIFPLIANDKGVLGRNGHTEATVDLMKLSGFNSAGVLCELMNKDGTMMKA
AELEAFAKKHDLPLLTIAELYQYRLATEIFVTKMASSTIPFKKIGELEMSVYKDNFSGDE
VVVLSKPYSGNNPLVRMHSSCMTGDIFGSLRCDCQDQLHKGIEMISEEGGFFIYLDQEGR
GIGLTNKLKAYNLQMNENMDTLEANLALGLPADARKYDLAIQVLKYNNVNRCRLISNNPE
KLAALRNVDIETQPVYCEAFVNSHNRNYLITKKIKAKHTIKGI
//