[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30340.1"

            "short-chain dehydrogenase/reductase"
            ""

OrgPattern --1---1-1111111--1---1--52224224-1---------1-122--512-11-----12-1-24 49C-G312335562CKGBA-B933GPBBBBBFLKKK8IFA-4286132-621433312--568-84A9C14-111---112261-1111121-2-----85I477o7J38--------------3321774223352448611161E88976655---1-1212336C9I711211111-1118523323-55B66666687878666776667C676565CC865334335G44444433334443375554415135131218A33345332678774342454333233232333324644665665566322222222421556444444424122442243331-1-521122---1251111111-1427C444-21-1D7E883146765455655554667-987748899EC1NEE8LFHMQHDC6547637746366663333333326672342---1-111-----111-11--2--1111-468A4357546HHJFLJ67887FFLG979935GDM7GDE137763335564867159213453111111112245536E381-1---2---136214-1411631BC-311-1-2211311211111112-21311565755827444223429475545466435--212431-----349A2723554354443-533454444354333333459656324423445444434444592232222--4656766565761--41111177771866A222312211112221CCBDD7A57463BBAA65B9D879B796644444444423448555555534425797971112-1-1112872144--------1-3----2---3-1------31------2211123221261 11--WN6-311-1358896EABCBGCH5544446854544444222F7GT9CPO9BA7566732454225324242212224448542-FY984F5----223A87-456nPNEDIE56649E6NJ6H5QvI-HCF87A7E89GE49667G22ECGHJRKPI5OHJ3BDGI49SQ25412---3A634D78641D7FB- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTN:Sequence :cccccEEEEEccccccHHHHHHHHHHHTcTTccEEEEEEEccGGGTHHHcEEEEEccTTc:Sec Str : =======================================================:RP:SCP|6->264|1a27A|2e-39|26.3|255/285|c.2.1.2 : =======================================================:BL:SWS|6->271|YBBO_ECOLI|2e-46|40.5|252/269 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->167|PF00106|6e-17|36.9|160/169|adh_short 61: . . . * . .: 120 :YEYIDNALADILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKA:Sequence :HHHHHHHHHTcHHHTTccccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->264|1a27A|2e-39|26.3|255/285|c.2.1.2 :============================================================:BL:SWS|6->271|YBBO_ECOLI|2e-46|40.5|252/269 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->167|PF00106|6e-17|36.9|160/169|adh_short 121: . . + . . .: 180 :LKIMRKQGYGKIIQHSSVLGLVAMKYRGAYNASKYAIEGLTDTMRLELRDSNIFITSLNT:Sequence :HHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEE:Sec Str : ############################# :PROS|137->165|PS00061|ADH_SHORT|PDOC00060| :============================================================:RP:SCP|6->264|1a27A|2e-39|26.3|255/285|c.2.1.2 :============================================================:BL:SWS|6->271|YBBO_ECOLI|2e-46|40.5|252/269 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->167|PF00106|6e-17|36.9|160/169|adh_short 181: . * . . . .: 240 :GPITSKFRENSIKTITNVNYDSSVHKQQYEKILARQHKKVPFNEPAISVAKVVEKIINCD:Sequence :ccccccTTTTccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcc:Sec Str :============================================================:RP:SCP|6->264|1a27A|2e-39|26.3|255/285|c.2.1.2 :============================================================:BL:SWS|6->271|YBBO_ECOLI|2e-46|40.5|252/269 241: + . . . . *: 300 :KPKPRYYITKATWIMTSLKRILPTNILDNFLNRY :Sequence :ccccEEEcccTTHHHHHTTTccTT :Sec Str :======================== :RP:SCP|6->264|1a27A|2e-39|26.3|255/285|c.2.1.2 :=============================== :BL:SWS|6->271|YBBO_ECOLI|2e-46|40.5|252/269