[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30405.1"

            "lipoprotein, putative"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-----------1----1-------------------------------------11----1--1-1111111111111111111--------------------------------------------------------------------------------------------------------------1------------------------------------11---------222222222-11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKTKSYSLLLLLCGVISSCTTFSGSHPDKVDNAKKAIETCQYKPTETKFIKTFDNDGVDA:Sequence : :Sec Str 61: . . . * . .: 120 :AIGFLETGRFEQLISNTTLSQKKYTKATDYVAKSEAEAKIRVRNILKDTQATLLSDKERY:Sequence : :Sec Str 121: . . + . . .: 180 :YYITDYEITFLYAYQALNYLKQHDLENAAVSIRNLSYAQYATFQAKDLATQTRDTNYQEL:Sequence : :Sec Str 181: . * . . . .: 240 :SHVNSRQISSNISNSKQYRQLATIASRVRNSYENAFGYYLEAIIYQSYDTDLNNANLSMS:Sequence : :Sec Str : XXXXXXXX :SEG|188->195|issnisns 241: + . . . . *: 300 :NAFRVVPDNPYVSADYQQIKKAFDSGGNIYPQDQGKLVIIYESGWVEPLKKFDIPKTIFF:Sequence : :Sec Str 301: . . . . + .: 360 :QQAGVQKISLPYYGSYNLAQNADIQIFKDNKLIDHGKSALLVDTTAMAAKSLSDQYPAIV:Sequence : HHHHHTTccEEEEEEcccGGGccc cc:Sec Str 361: . . . * . .: 420 :TREVLRLVTKTAISVAAIRSSGDYAALAAIGTSIYNLATTEADQRSWNLLPKNVDLFSKN:Sequence :cEEEEEEEcTccccEEEEEEccccEEEEEEcTTTccEEEEcccHHHHHHH :Sec Str 421: . . + . . .: 480 :LAVGKYTLKINNKSTTVTLQPQKITLVWLTKEGCYEQILLNQVL :Sequence : :Sec Str