[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30434.1"

            "pilus assembly protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLLQQIKSQAGFGIVESMLAALILLFVLSSGFLLLNSVLVNITLENKKDEIATILDERIS:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|22->41|lillfvlssgflllnsvlvn 61: . . . * . .: 120 :IYRLTGVFDDTKTKDGIEFIKTVVLEKQNEAKPEENLETVNRFKPLSVADIRKMAEKADK:Sequence : XXXX:SEG|117->129|kadkknqkaaand 121: . . + . . .: 180 :KNQKAAANDVDIIYKVVNIAAIDNQLGVADCVKIIEREVKQDDNQAQ :Sequence :XXXXXXXXX :SEG|117->129|kadkknqkaaand