[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30434.1 ftul2 ACD30434.1 "pilus assembly protein"
MLLQQIKSQAGFGIVESMLAALILLFVLSSGFLLLNSVLVNITLENKKDEIATILDERIS
IYRLTGVFDDTKTKDGIEFIKTVVLEKQNEAKPEENLETVNRFKPLSVADIRKMAEKADK
KNQKAAANDVDIIYKVVNIAAIDNQLGVADCVKIIEREVKQDDNQAQ
//