[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30480.1"

            "transcriptional regulator, ArsR family"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------1---1------------------------------------------------------------------------------------1----------------------------1---------------------------------------------------------------------------2---------------11------1-1-11--33---1----1-1---1-------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------1------------1--------------------1---------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------111111111-------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIH:Sequence :EEEEccHHHHHHHTcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEE:Sec Str : ===========================================================:RP:SCP|2->80|1fnnA1|1e-12|13.9|79/103|a.4.5.11 : ==================================================:BL:SWS|11->80|CADF_STAAU|2e-09|35.7|70/121 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|15->59|PF01022|3e-07|42.2|45/47|HTH_5 61: . . . * . .: 120 :KRKQGRFHYFYFNSAYQQQLNWLFDILADDEIIQSDQKLVKQLIAQELEHLPEIHAKENI:Sequence :EEEEEEETTEEEEcccEEEEcTTcccHHHHHHHHHHHHHHHHHHHHTTccccHHHHHH :Sec Str :==================== :RP:SCP|2->80|1fnnA1|1e-12|13.9|79/103|a.4.5.11 :==================== :BL:SWS|11->80|CADF_STAAU|2e-09|35.7|70/121 121: . . + . . .: 180 :L :Sequence : :Sec Str