[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30541.1"

            "conserved hypothetical membrane protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1-111--------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1--IOKCFJE3263275DB1B2ISB-98F4523D-7B837354732F387771483F7517125395------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRNIYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIF:Sequence : HHHHHHccccccccccEEEEEcEEEEEEEEEETTTTEEEEEEEE:Sec Str : ==============================:RP:SCP|31->226|1i9bA|7e-14|15.1|179/205|b.96.1.1 : ==============================:BL:SWS|31->291|ELIC_ERWCH|5e-19|26.2|244/321 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->193|PF02931|8e-14|31.4|153/206|Neur_chan_LBD 61: . . . * . .: 120 :RFSWNDQRLEFDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYP:Sequence :EEEEEcGGGcccTTTcccccEEccTTcccccGGTcccccEEccccccccEEEEEEEEEcT:Sec Str :============================================================:RP:SCP|31->226|1i9bA|7e-14|15.1|179/205|b.96.1.1 :============================================================:BL:SWS|31->291|ELIC_ERWCH|5e-19|26.2|244/321 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->193|PF02931|8e-14|31.4|153/206|Neur_chan_LBD 121: . . + . . .: 180 :NGDIIYTEQRTLHLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYV:Sequence :TcEEEEEEEEEEEEEccccGGGGGGcEEEEEEccEEEcccccEEEEEcGGGcccGGGccc:Sec Str :============================================================:RP:SCP|31->226|1i9bA|7e-14|15.1|179/205|b.96.1.1 :============================================================:BL:SWS|31->291|ELIC_ERWCH|5e-19|26.2|244/321 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->193|PF02931|8e-14|31.4|153/206|Neur_chan_LBD 181: . * . . . .: 240 :KDHPNINVAEWHLSNFDLKNIEPIKYYYGKPQRISMLEFSISLERKPTNILLKVLIPLTL:Sequence :cccTTcccTTEEEEEEEcEEEEEEEEEcccccEEEEEEEEEEEEEccHHHHHHTHHHHHH:Sec Str : XXXXXXXXXXX:SEG|230->243|illkvlipltllvl :============================================== :RP:SCP|31->226|1i9bA|7e-14|15.1|179/205|b.96.1.1 :============================================================:BL:SWS|31->291|ELIC_ERWCH|5e-19|26.2|244/321 :$$$$$$$$$$$$$ :RP:PFM|32->193|PF02931|8e-14|31.4|153/206|Neur_chan_LBD 241: + . . . . *: 300 :LVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGEMPDIDYLTFTDGFLLLSFSI:Sequence :HHHHHHTTcccccHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHH:Sec Str :XXX :SEG|230->243|illkvlipltllvl : XXXXXXXX:SEG|293->303|flllsfsilfs :=================================================== :BL:SWS|31->291|ELIC_ERWCH|5e-19|26.2|244/321 301: . . . . + .: 360 :LFSTVLESLAVYWLIKLNKDKLARKMDIFSRFVFPISYLVLITSLYFIYLH :Sequence :HHHHHHHHHHHHHT :Sec Str :XXX :SEG|293->303|flllsfsilfs