[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30541.1 ftul2 ACD30541.1 "conserved hypothetical membrane protein"
MRNIYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIF
RFSWNDQRLEFDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYP
NGDIIYTEQRTLHLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYV
KDHPNINVAEWHLSNFDLKNIEPIKYYYGKPQRISMLEFSISLERKPTNILLKVLIPLTL
LVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGEMPDIDYLTFTDGFLLLSFSI
LFSTVLESLAVYWLIKLNKDKLARKMDIFSRFVFPISYLVLITSLYFIYLH
//