[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30665.1"

            "DNA/RNA endonuclease G"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1131-1-------11-12---------------------------11-1-------3-11---------------1--22321------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------11112111-------------------------------11111111-1-3---------------------------------------1---1------1------11-------2----211111--1--1322---------------------2-----------------1-11----3----11-------131111---111111-------11------1------------------------1------------------------------------------------------1-11111111--1-111---------1--------1---------------1--1----------------1111111111---------1---------1111111111----------1-11-121211111--------------11111111----------------------------------------- --11112-----11211111111212111-1111111111111111111111111111111111111111111-11111111111111-11111111111111223-122714115-111-111221224E2-2221112222231221121122221211-12111312-1137-12-6111-1---11---11211- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTKKTSKQKDTKKQTTKKPINYIKIFILLALTIGGGFSGIFFDKFDLKEKFINFRHAVYN:Sequence : :Sec Str : XXXXXXXXXXXXXXXXX :SEG|2->18|tkktskqkdtkkqttkk 61: . . . * . .: 120 :YFTSEPIKHYTTKDNENITARFFSQSDEGKKQQQQSNEFDNLKQYPPVRTLPAVTDYCHG:Sequence : :Sec Str 121: . . + . . .: 180 :FLAYGNPSYGVTDGLGQANLYLCRDGYVVGYNYQTKEASWVAFELTKSKVANHLKRDDRF:Sequence : GTTccTTcccccTTcTTcEEEEccccEEEEETTTTEEEEEEEEEcHHHHcccTTccGGc:Sec Str : ==========================================================:RP:SCP|123->344|1g8tA|8e-59|32.1|212/241|d.4.1.2 : ===========================================================:BL:SWS|122->335|NUC1_CUNEE|1e-35|40.8|206/252 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->333|PF01223|9e-34|42.7|185/198|Endonuclease_NS 181: . * . . . .: 240 :KEDSDVPFVYRATLDDYSRSGYDRGHLASYASMDFSKKSADQSFLLSNMSPQKAGLNRQG:Sequence :cccTTccGGGcccHHHHTTTTcEEEEcccGGGccccHHHHHGGGcGGGEEEEcccccTTH:Sec Str : ######### :PROS|203->211|PS01070|NUCLEASE_NON_SPEC|PDOC00821| :============================================================:RP:SCP|123->344|1g8tA|8e-59|32.1|212/241|d.4.1.2 :============================================================:BL:SWS|122->335|NUC1_CUNEE|1e-35|40.8|206/252 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->333|PF01223|9e-34|42.7|185/198|Endonuclease_NS 241: + . . . . *: 300 :WERLETDERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKIAVPDYFFKIIYVPSKNQAIA:Sequence :HHHHHHHHHHGGGTccEEEEEEEEEccEEccccEETTTTEEcccEEEEEEEEEcccccEE:Sec Str :============================================================:RP:SCP|123->344|1g8tA|8e-59|32.1|212/241|d.4.1.2 :============================================================:BL:SWS|122->335|NUC1_CUNEE|1e-35|40.8|206/252 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->333|PF01223|9e-34|42.7|185/198|Endonuclease_NS 301: . . . . + .: 360 :FVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTNISNRDAVINSVSSMWRTTYL :Sequence :EEEEcccccTccGGGGcccHHHHHHHHTccccTTccGG :Sec Str :============================================ :RP:SCP|123->344|1g8tA|8e-59|32.1|212/241|d.4.1.2 :=================================== :BL:SWS|122->335|NUC1_CUNEE|1e-35|40.8|206/252 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|145->333|PF01223|9e-34|42.7|185/198|Endonuclease_NS