[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30667.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKIITLSTLLLISLTSIAFSKELNNYSDILNAVKDGKNITIFVDFSNCKPEIKVSGQFS:Sequence : XXXXXXXXXXXXXXX :SEG|4->18|iitlstlllisltsi : ========================================:BL:SWS|21->98|Y4WH_RHISN|3e-04|30.7|75/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->111|PF06903|2e-12|43.3|90/117|VirK 61: . . . * . .: 120 :PKSIMIHNDSIIFSDTHFTRNNPQYLNEPILEYVVYKINGNNVNITIDILDANNSPMEHS:Sequence :====================================== :BL:SWS|21->98|Y4WH_RHISN|3e-04|30.7|75/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|19->111|PF06903|2e-12|43.3|90/117|VirK 121: . . + . . .: 180 :KRITIGCQITKDQASFFSN :Sequence