[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30777.1"

            "glutamine amidotransferase class-II family protein"
            ""

OrgPattern ---------------------------------1--------------------1------------- ----2------------11-11--1-111111----1223-1-2--------1-------11--1-1121------------1-------------------------1-------------------------------------1-1111------------1111121-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------11111-11111-22122122-1--1111111111111-----111111-11--------------1--------------------------------1-------11111111111111111111111111111--11----------------------------------------------------------2112-----------------------------------------------1------2------------1--------------------------------------------------------------------------------------------------22121---1--------------------------1-----------------111111111-----11111--111------------------------------------------------------------------------- ----111--------22221111111111111111111111111111111111111111-11111111-11111111-11111111---142211-1111121111--4------------------------------------------------------------------1-1111111-----2--1-----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MCRWLMYHGDKIKMSDLLVDPENSLIHQSIHSSQGAVPVNGDGFGVGWYTSLHKEPGVYK:Sequence :EEEEcTTcccHHHHHHHHHHHHHHHHHHHHHHTccccEEcccEEEEEEEcTTccEcEEEE:Sec Str : ===========================:RP:SCP|34->194|1te5A|2e-22|24.3|148/253|d.153.1.1 :============================================================:BL:SWS|1->161|YNT1_YEAST|7e-31|46.0|161/357 61: . . . * . .: 120 :DPLPAWNNQNLISLAKHIKSRNFMAHVRASTIAPTSRVNCHPFTFKNHLFMHNGSIAGFD:Sequence :EEEccHHHHHHHHHHccccccEEEEEEEccccccccGGGcccEEETTEEEEEEEccTTHH:Sec Str :============================================================:RP:SCP|34->194|1te5A|2e-22|24.3|148/253|d.153.1.1 :============================================================:BL:SWS|1->161|YNT1_YEAST|7e-31|46.0|161/357 121: . . + . . .: 180 :DIRQEIEQLVKPQYFKARFGSTDSEAIFLLAVSNGLENDPKLAIVKSIEQITKIQAKNGL:Sequence :HHHHHHHHTHHTccccccTcccHHHHHHHHHHHHHTTccHHHHHHHHGGGccccEEHHHH:Sec Str :============================================================:RP:SCP|34->194|1te5A|2e-22|24.3|148/253|d.153.1.1 :========================================= :BL:SWS|1->161|YNT1_YEAST|7e-31|46.0|161/357 181: . * . . . .: 240 :KESIKASIAYSNGEISYSLKISTIGNEPSLYYISYKDIIETLDLKKKNKFKNGFVVLSEP:Sequence :HHHHHHHcccccccEEEEE :Sec Str : XXXXXXXXXXXXXX :SEG|224->237|lkkknkfkngfvvl :============== :RP:SCP|34->194|1te5A|2e-22|24.3|148/253|d.153.1.1 241: + . . . . *: 300 :LVKSDSYSYVNNYTCIEIRQNEFKVEKL :Sequence : :Sec Str