[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30777.1 ftul2 ACD30777.1 "glutamine amidotransferase class-II family protein"
MCRWLMYHGDKIKMSDLLVDPENSLIHQSIHSSQGAVPVNGDGFGVGWYTSLHKEPGVYK
DPLPAWNNQNLISLAKHIKSRNFMAHVRASTIAPTSRVNCHPFTFKNHLFMHNGSIAGFD
DIRQEIEQLVKPQYFKARFGSTDSEAIFLLAVSNGLENDPKLAIVKSIEQITKIQAKNGL
KESIKASIAYSNGEISYSLKISTIGNEPSLYYISYKDIIETLDLKKKNKFKNGFVVLSEP
LVKSDSYSYVNNYTCIEIRQNEFKVEKL
//