[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30798.1"

            "ROK family protein"
            ""

OrgPattern --1----------------------------------------------------------111---- 121-1121111--1-----------1-----------111--111-------111--2--1--1---3331----2111-1-1--1-11-41-2-------1---11111--------------1--1-1-1-11----1-11-5-1111111--11-1111111112221-1-----1----1----33-211111112322232223132232122122-21-666774-3--------------------211-11-11-11111--312--12231111321211322233232322222222222222222111211211-161111111212-11113332111-11--1----114-1-754111--1-1-------------------------------1--1------1---411211-222--------1------1----------------------------------------------1---------------------------------------------------------------------------------------------1----------1--------------------------------1-------1-1111-------------1--1-----------22----------------------------------111-----1111111111111111----------1-------------------------------------------------------------------------211111111-122-11111-----------------------111111-1-1-1-1----------------------------1331124323--2 --------------------------------------------------------------------------------------------------------------3111121111-11132111381-1141-11111111-11-111111111---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIA:Sequence :ccccEccTTEEEEEEEEcccEEEEEEEcTTccEEEEEEEEEccccccHHHHHHHHHHHHT:Sec Str : ====================================================:RP:SCP|9->131|1woqA1|2e-19|26.7|120/129|c.55.1.10 : ================================================:BL:SWS|13->257|XYLR1_BACSU|2e-21|33.1|242/384 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->182|PF00480|5e-19|35.8|165/181|ROK 61: . . . * . .: 120 :KVFTSEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCF:Sequence :TTGTGGccEEEEEEccEEETTEEEcccGGGGGGGTTccHHHHHHHHHcccEEEEEHHHHH:Sec Str :============================================================:RP:SCP|9->131|1woqA1|2e-19|26.7|120/129|c.55.1.10 :============================================================:BL:SWS|13->257|XYLR1_BACSU|2e-21|33.1|242/384 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->182|PF00480|5e-19|35.8|165/181|ROK 121: . . + . . .: 180 :AIGQRLYGKGKQYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC:Sequence :HHHHHHTccTTGcccEEEEEEcccEEEEEEETTEEEccTTcccccGGGccccTTccccTT:Sec Str : XXXXXXXXXXXXX :SEG|138->150|gitigtgigggii :=========== :RP:SCP|9->131|1woqA1|2e-19|26.7|120/129|c.55.1.10 : ============================:RP:SCP|153->259|2hoeA2|1e-16|21.5|107/168|c.55.1.10 :============================================================:BL:SWS|13->257|XYLR1_BACSU|2e-21|33.1|242/384 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->182|PF00480|5e-19|35.8|165/181|ROK 181: . * . . . .: 240 :SGQFFIKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSI:Sequence :cccccHHHHTccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHH:Sec Str :============================================================:RP:SCP|153->259|2hoeA2|1e-16|21.5|107/168|c.55.1.10 :============================================================:BL:SWS|13->257|XYLR1_BACSU|2e-21|33.1|242/384 :$$ :RP:PFM|14->182|PF00480|5e-19|35.8|165/181|ROK 241: + . . . . *: 300 :ISAREFFEKAMWDEIKTFAFINQLKKLK :Sequence :HTcTTHHHHHHGHHHTTccGGGccETcc :Sec Str :=================== :RP:SCP|153->259|2hoeA2|1e-16|21.5|107/168|c.55.1.10 :================= :BL:SWS|13->257|XYLR1_BACSU|2e-21|33.1|242/384