[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30798.1 ftul2 ACD30798.1 "ROK family protein"
MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIA
KVFTSEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCF
AIGQRLYGKGKQYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC
SGQFFIKKIGVEGVEILKRARNNDKDTINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSI
ISAREFFEKAMWDEIKTFAFINQLKKLK
//