[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30867.1"

            "CBS domain pair protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------11-1---------------------------------------------------------11---1--1-1--------11------11--1---1--1---------------------------------------------------------------------------------------------111-1--------1--------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDLKEFKKIELSHFKDAKSVNYLRDDVNHLLYLDSPALDVFRDYKEHDALVVKADVNLKD:Sequence : ============================:RP:SCP|33->156|2v8qE1|4e-05|10.3|117/145|d.37.1.1 61: . . . * . .: 120 :VKTKLIDNHKDFILVTDGEDKVIGSIALHYIQSQALNERARSSGTKPADLIANDIMLPIA:Sequence :============================================================:RP:SCP|33->156|2v8qE1|4e-05|10.3|117/145|d.37.1.1 121: . . + . . .: 180 :KANVVSFSIIENSKIGHVVNTLINSDYHHIIVYDKDKNGEKYIRGYFSLPYIRRKLSLDV:Sequence :==================================== :RP:SCP|33->156|2v8qE1|4e-05|10.3|117/145|d.37.1.1 181: . * . . . .: 240 :YHVYQKQGISNLNRGI :Sequence