[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30867.1 ftul2 ACD30867.1 "CBS domain pair protein"
MDLKEFKKIELSHFKDAKSVNYLRDDVNHLLYLDSPALDVFRDYKEHDALVVKADVNLKD
VKTKLIDNHKDFILVTDGEDKVIGSIALHYIQSQALNERARSSGTKPADLIANDIMLPIA
KANVVSFSIIENSKIGHVVNTLINSDYHHIIVYDKDKNGEKYIRGYFSLPYIRRKLSLDV
YHVYQKQGISNLNRGI
//