[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30912.1"

            "short chain dehydrogenase"
            ""

OrgPattern 2221235BB9B9A887192531218228555822---------21143--622-23112133854144 GHP5c3-555D351SsbHH-Hl33Y*HGHHHPms*uUh**5h9*JKD73CA2OFK94911GGQ3IGYUXOE11113121196S11433768628221--75Q6CEoER6I11111111111111254388422674CAAII222G999GC7673233221543243BFAT8212132222212CB778661FAOGGHGHJHJEJIHIJHMHOOIPHIICIJMOIF888887JY766666546666665CBBBB91A28A2611168557968689965576757674444444445444456666667666664552225557435AD5554444546956626756341188322A6122324333355532B2DjGGR12212M8*gd66BWQTUNJKNJIILJNLU-GLPJEhBNStZ2wbbMcZe*yvmiYYHGCLIXPHNRGEM99999999OQPD6CA811111111111122331221222121111BEo*I9KicRb*msowuSPPQNllyuTSTTBR*U*Q*nb58STNI9HGGTHYInk8E8584AB62332222248JD86I67312112422324754C538499B9KL32333323322423323333332243466CC97BED8MC56A98A9FC8987B6A88791-33338111111DEGF6K7DEEDDCCCDD-EDEDDBCDCDECFCCDDCDNWPD979AB89AAABABBA9A9AARACAAA9C319AAAAAA9AAAA111535234BDBB4CHNG222627222222463GHIMH6I6A7KASSORGOOXGJJOLGPLL7675576564545E555558A679IKMJMIFCDF65552254CB8877--------1-4----1---3-1------31------34422666763B3 11--57B-512-5BBWhUQVSaLneoTFH8DCEEFB8NDKCLLC9BQQQebg*zINNIFLEI88D2642A2277A23223499B9C1B-IfHhDZECAB9B8AFGD-AKB*LJGFGD63514C6FC2C6L*E-DFF4483F69B839546D33C599HMaXRAYMEECAE7BRME5693h2325JDVOsUaFC9ZGKJD --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----

Master   AminoSeq   


1: . . . . + .: 60 :MSNRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTL:Sequence :TTTcEEEEETTTcHHHHHHHHHHHHTTcEEEEEEccHHHHHHHHTcEEcTTcHHHHHHHH:Sec Str : ======================================================:RP:SCP|7->232|1pwxA|1e-45|23.0|226/252|c.2.1.2 :============================================================:BL:SWS|1->232|FABG_VIBHA|3e-32|34.5|229/244 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->157|PF00106|3e-11|30.5|154/169|adh_short 61: . . . * . .: 120 :IQINEIHGCPDAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQ:Sequence :HHHHHHHccccEEEEcccccccccTTTccHHHHHHHHHHHTHHHHHHHHHHHHHHGGGTc:Sec Str :============================================================:RP:SCP|7->232|1pwxA|1e-45|23.0|226/252|c.2.1.2 :============================================================:BL:SWS|1->232|FABG_VIBHA|3e-32|34.5|229/244 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->157|PF00106|3e-11|30.5|154/169|adh_short 121: . . + . . .: 180 :CKIVNIASRAIFGVKNRTSYSAAKSALVGCTKTWALELAKYGICVNAIAPGPVDTELFRK:Sequence :EEEEEEccGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEcccccHHHHH:Sec Str :============================================================:RP:SCP|7->232|1pwxA|1e-45|23.0|226/252|c.2.1.2 :============================================================:BL:SWS|1->232|FABG_VIBHA|3e-32|34.5|229/244 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->157|PF00106|3e-11|30.5|154/169|adh_short 181: . * . . . .: 240 :TRPIGSSEEKEVLDSIPMMRIGKPEEIAATIAFLLSNEASFITGQVICVDGGGSL :Sequence :HccHccccHHHHHTTcTTcccccHHHHHHHHHHHHcGGGTTccccEEEEcTTccc :Sec Str :==================================================== :RP:SCP|7->232|1pwxA|1e-45|23.0|226/252|c.2.1.2 :==================================================== :BL:SWS|1->232|FABG_VIBHA|3e-32|34.5|229/244