[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD30916.1"

            "conserved hypothetical protein"
Y995_FRATM  "RecName: Full=UPF0145 protein FTM_0995;"

OrgPattern ------------1-1--1------------1-2---------1------------1---1-------- --1-------------------------------------------------1----------------------------------------1-----------------------------------------------111--------------------------------------------1----1-----------------11--------1---------11------------------------------------------------------------------------------------------1-------------------11----------1-------------1--1---1-----------1------------------------------------------------1-------------------------1-----------------------------------------1111111111111-111111111----------------------------1-----------------------------------------------------------------------------------1------1---------------------------------------------------------------------------------------------------------------------1111--1-----------------------1----------------------111111111----------11----1---------------1------------------------------------------1--11-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MILTTADTLGKREIIEYKGLVTGIIVRTPTITQGILGGLKNIIGGKNTSYTNVCKEARLH:Sequence :cEEccccccTTEEEEEEEEEEEEEEEEcHHHHHHHTTTccccccTTTcTHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|34->47|gilgglkniiggkn :============================================================:RP:SCP|1->105|1vr4A1|2e-22|34.0|103/103|d.230.5.1 :============================================================:BL:SWS|1->106|Y995_FRATM|8e-47|100.0|106/106 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->103|PF01906|7e-12|39.6|101/105|DUF74 61: . . . * . .: 120 :AEQEMINQAKELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR :Sequence :HHHHHHHHHHHHTccEEEEEEEEEEEEcTT ccEEEEEEEEEEEE :Sec Str :============================================= :RP:SCP|1->105|1vr4A1|2e-22|34.0|103/103|d.230.5.1 :============================================== :BL:SWS|1->106|Y995_FRATM|8e-47|100.0|106/106 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|2->103|PF01906|7e-12|39.6|101/105|DUF74