[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD31006.1"

            "drug:H+ antiporter-1 (DHA2) family protein"
            ""

OrgPattern ---1--6444444452-3111--2--------1121--1111-8A52421642-1--11-13451--- 4354c33677754585677-7811FB7777778788AHFC4F8E787247426775-4--BD6344BLIH22111322-12-3131113311-2-----2-61-1B-3-2--------------111111-1111-4553321153--1---------1---1---1--3-------------2241---272BBBCBCBBE6DECBCC729759BCC33455528787878M343333333333333644664662AC33415BA66A6637556553222----123-----------11111111111111-----1------9C111212121133AA1443-----4--2-463331-12321111--12-71151112235A98423775543354345565A-444447482A--F666BC5EFC467411----2122---5555555554544116------------1111111111111--1--144335735AMOPQQNGDDDDJJQOFFEG9GUIN7AAE--99B11533537393251-111542222222-1-113125-312112211322-1321321322351123-----------1--------111-77446141--23222222112433113111211-1----------78873A36777688866-7658778666797666665CIEAA6957748666666657585F665656411755555555555--1-6637521111-543111-31-22-1-11377787131123166567A8A25663146543533633313454333333322344444443221--------------------------------------------------2----1---231 ----11-------14ILWGTSYTqfvRKICFDETNHFEBC8DGEFDTIHUUWrZCFLJEBBE639-3C353292E-422429BB89B6-KL8L5D76578717BBA--1-------------------------------------------------1----1-----------------------2-K1---1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQASNTITVGFWSQKRTIVALAISLLALAEIVDLTIVAVAIPQIMGAIGANVETIADVTT:Sequence : HHHHHHHHHHHTTcccTTHHHHHHHH:Sec Str : XXXXXXXXXX :SEG|20->29|alaisllala : ============================:RP:SCP|33->211|1pw4A|3e-10|11.8|178/434|f.38.1.1 : ===============================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->387|PF07690|1e-16|23.6|313/347|MFS_1 61: . . . * . .: 120 :VYIVTAAIFILLSGLIIEKYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGG:Sequence :HHHHHHHHHHTTHHHHHTcccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEc:Sec Str :============================================================:RP:SCP|33->211|1pw4A|3e-10|11.8|178/434|f.38.1.1 :============================================================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->387|PF07690|1e-16|23.6|313/347|MFS_1 121: . . + . . .: 180 :AFLPSVAQTYISTSFKNEEYNKMMTIYSMVIVMGPIIGPVLGGAICENMSWEWIFYVNVP:Sequence :cccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEccTTcTTcccHHHH:Sec Str :============================================================:RP:SCP|33->211|1pw4A|3e-10|11.8|178/434|f.38.1.1 :============================================================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->387|PF07690|1e-16|23.6|313/347|MFS_1 181: . * . . . .: 240 :LCIVAFIIIAFMMEATQIKKIKIDYISFGFMAIGVGCLELFIDNGNTNGWFSSIKMIILL:Sequence :HHHHHHHHHHHHccccTT :Sec Str :=============================== :RP:SCP|33->211|1pw4A|3e-10|11.8|178/434|f.38.1.1 :============================================================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->387|PF07690|1e-16|23.6|313/347|MFS_1 241: + . . . . *: 300 :AISLVSIGFFIWRGLIYSSVVKFKIFKNFNFVLACFLCFMFVLLFSAAMAYLPTMLQQVY:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|260->272|vvkfkifknfnfv :============================================================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->387|PF07690|1e-16|23.6|313/347|MFS_1 301: . . . . + .: 360 :GYPVDLAGYITAPRGIAAIIGAMLTQSILVKKLGVRKTISLGMITFGVSCLMQANFSPTA:Sequence : :Sec Str :============================================================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->387|PF07690|1e-16|23.6|313/347|MFS_1 361: . . . * . .: 420 :NEFDIILTTAIQGLGMMMFFVPFMSVLVVGVADEDMGDMSGSFNFFRNFGSSVGTAFVAT:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|400->412|sgsfnffrnfgss :============================================================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|32->387|PF07690|1e-16|23.6|313/347|MFS_1 421: . . + . . .: 480 :FISRNQQTTYLELSQNISSLNNNFQSWSHSLPMPDLATVALAKQQVLHQSSLLSYINSFY:Sequence : :Sec Str :============================================================:BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512 481: . * . . . .: 540 :VVGILSLILAIVPFLLKEPPTGAPVAVMH :Sequence : :Sec Str :==================== :BL:SWS|30->500|EMRB_ECOLI|7e-48|26.9|468/512