[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD31006.1 ftul2 ACD31006.1 "drug:H+ antiporter-1 (DHA2) family protein"
MQASNTITVGFWSQKRTIVALAISLLALAEIVDLTIVAVAIPQIMGAIGANVETIADVTT
VYIVTAAIFILLSGLIIEKYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGG
AFLPSVAQTYISTSFKNEEYNKMMTIYSMVIVMGPIIGPVLGGAICENMSWEWIFYVNVP
LCIVAFIIIAFMMEATQIKKIKIDYISFGFMAIGVGCLELFIDNGNTNGWFSSIKMIILL
AISLVSIGFFIWRGLIYSSVVKFKIFKNFNFVLACFLCFMFVLLFSAAMAYLPTMLQQVY
GYPVDLAGYITAPRGIAAIIGAMLTQSILVKKLGVRKTISLGMITFGVSCLMQANFSPTA
NEFDIILTTAIQGLGMMMFFVPFMSVLVVGVADEDMGDMSGSFNFFRNFGSSVGTAFVAT
FISRNQQTTYLELSQNISSLNNNFQSWSHSLPMPDLATVALAKQQVLHQSSLLSYINSFY
VVGILSLILAIVPFLLKEPPTGAPVAVMH
//