[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD31051.1"

            "hypothetical membrane protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNLNFKGTISLAATIYKRAFKITFALAFMLSFISEFCFVYLMNHGMDKFIQSNGEADVS:Sequence 61: . . . * . .: 120 :QLPSGNILAAMFLIIMVATIFVYAMIIILQGIMIKHELKVSDALKIALQIFSKRVFAFLR:Sequence : =================================================:BL:SWS|72->180|UPPP_WIGBR|7e-04|29.7|101/100 121: . . + . . .: 180 :AFLLSMIAMTLLTMFLQYIGIFLAILLFLTVMPAVLLAQKGVFESLSANFYAVKNNFFYM:Sequence :============================================================:BL:SWS|72->180|UPPP_WIGBR|7e-04|29.7|101/100 181: . * . . . .: 240 :FRISITILAFMIIKPLLTFGLIYLLKDLGVEIGSLEMSIQNIVVTVVDAFILPFIFAISV:Sequence : XXXXXXX:SEG|234->248|fifaisvaaffstss 241: + . . . . *: 300 :AAFFSTSSK :Sequence :XXXXXXXX :SEG|234->248|fifaisvaaffstss