[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD31051.1 ftul2 ACD31051.1 "hypothetical membrane protein"
MSNLNFKGTISLAATIYKRAFKITFALAFMLSFISEFCFVYLMNHGMDKFIQSNGEADVS
QLPSGNILAAMFLIIMVATIFVYAMIIILQGIMIKHELKVSDALKIALQIFSKRVFAFLR
AFLLSMIAMTLLTMFLQYIGIFLAILLFLTVMPAVLLAQKGVFESLSANFYAVKNNFFYM
FRISITILAFMIIKPLLTFGLIYLLKDLGVEIGSLEMSIQNIVVTVVDAFILPFIFAISV
AAFFSTSSK
//