[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD31100.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------1111---111--111-1111111111-------------------111111111-1-------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTFQYINFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFI:Sequence : cTTHHHH HTTccccGG GcTTcEEEEEEEcTTccEEEEEE EE:Sec Str : ================================================:RP:SCP|13->179|1nrkA2|1e-32|32.3|164/243|d.250.1.1 : =====================================================:BL:SWS|8->245|Y466_HAEIN|7e-18|27.4|234/280 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->151|PF01571|8e-11|31.8|148/211|GCV_T 61: . . . * . .: 120 :SNEKLLLSVEQEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTS:Sequence :ETTEEEEEEEHHHHHHHHHHHHTTccccccEEEEEcccEETccccccTTccEEEETTEEc:Sec Str :============================================================:RP:SCP|13->179|1nrkA2|1e-32|32.3|164/243|d.250.1.1 :============================================================:BL:SWS|8->245|Y466_HAEIN|7e-18|27.4|234/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->151|PF01571|8e-11|31.8|148/211|GCV_T 121: . . + . . .: 180 :EMTFEQVRKENIINKLATINAANFEKFLPAELDLDNVDKVVCYTKGCYMGQEVIARMHYK:Sequence :HHHHHHHcTTHHHHTcccccGGGTTcccGGGGTGGGTTc ccccccccTTHH :Sec Str : X:SEG|180->193|kaklkkelavvkse :=========================================================== :RP:SCP|13->179|1nrkA2|1e-32|32.3|164/243|d.250.1.1 :============================================================:BL:SWS|8->245|Y466_HAEIN|7e-18|27.4|234/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->151|PF01571|8e-11|31.8|148/211|GCV_T 181: . * . . . .: 240 :AKLKKELAVVKSESDIDDFDLKDSEGKPLANVVNKVFVDNQCYMLVVFHKEASEQEYQLD:Sequence : :Sec Str :XXXXXXXXXXXXX :SEG|180->193|kaklkkelavvkse :============================================================:BL:SWS|8->245|Y466_HAEIN|7e-18|27.4|234/280 241: + . . . . *: 300 :DGKIITKC :Sequence : :Sec Str :===== :BL:SWS|8->245|Y466_HAEIN|7e-18|27.4|234/280