[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD31211.1"

            "major facilitator superfamily (MFS) transport protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111--11111-1--111-1---1---11111-1-1-------------------------------------------------------------------------------------------------------------------------------------------------1-1--1-----1-------22332333333---1-----132-33333344335622-212211111234--------1------1-----------------------------1---2-11111-------1111--1211111---1--------------------1-----------------------1------------------------------111-111111----------------21--1-211121211111122221211211---11-1------11211221111111111-111111111111111111111121211111111111111111121-11111--221222212222----11-11------1211--1---------------------1-22222131132231111111111111-1--11111111111--11111111--------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTVRQTLLIIITPIIAMCVLSFGNGFFTTYSSIELNDLGRSSLMIGIISAAYFFGMTAGS:Sequence : ==========================================================:RP:SCP|3->189|1pv6A|4e-06|13.9|187/417|f.38.1.2 : ================:BL:SWS|45->334|YCAD_ESCF3|1e-28|24.8|286/382 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->143|PF00083|5e-04|28.7|101/433|Sugar_tr 61: . . . * . .: 120 :YFSQFTIIRVGYIRAFVLFASLMAISTLIVGANKSVAVWILFRFLCGYSLAALFIIIESW:Sequence :============================================================:RP:SCP|3->189|1pv6A|4e-06|13.9|187/417|f.38.1.2 :============================================================:BL:SWS|45->334|YCAD_ESCF3|1e-28|24.8|286/382 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->143|PF00083|5e-04|28.7|101/433|Sugar_tr 121: . . + . . .: 180 :CILSSDKKNRGLIFSIYLFVYYGTQALSQLMINVHFSNGLLAYCFISSLCSIAIVLMAFT:Sequence :============================================================:RP:SCP|3->189|1pv6A|4e-06|13.9|187/417|f.38.1.2 :============================================================:BL:SWS|45->334|YCAD_ESCF3|1e-28|24.8|286/382 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->143|PF00083|5e-04|28.7|101/433|Sugar_tr 181: . * . . . .: 240 :KTVAPVPHSEEIYSPAKIIKKVPLAMVASVIGGSLLGSIYTLLPIFLVRVGSDHDMISVL:Sequence : X:SEG|240->251|lmmttilggmll :========= :RP:SCP|3->189|1pv6A|4e-06|13.9|187/417|f.38.1.2 :============================================================:BL:SWS|45->334|YCAD_ESCF3|1e-28|24.8|286/382 241: + . . . . *: 300 :MMTTILGGMLLQVPIGKLSDLIDRRKVIFLAGAGIFITSIFIFAFHTSYFLFAIIMFIFG:Sequence :XXXXXXXXXXX :SEG|240->251|lmmttilggmll :============================================================:BL:SWS|45->334|YCAD_ESCF3|1e-28|24.8|286/382 301: . . . . + .: 360 :GSAFVIYPLSISHASDFLNENEILGAIGVLTIAYGLGSVISPVVISGVMSVFGPFGFFII:Sequence : XXXXXXXXXXXXXXX :SEG|337->351|gsvispvvisgvmsv :================================== :BL:SWS|45->334|YCAD_ESCF3|1e-28|24.8|286/382 361: . . . * . .: 420 :TALLSISLCLYSAYRISVRKSATDRATFTIATPESLNFTEAQEIISEKSSEE :Sequence