[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD31211.1 ftul2 ACD31211.1 "major facilitator superfamily (MFS) transport protein"
MTVRQTLLIIITPIIAMCVLSFGNGFFTTYSSIELNDLGRSSLMIGIISAAYFFGMTAGS
YFSQFTIIRVGYIRAFVLFASLMAISTLIVGANKSVAVWILFRFLCGYSLAALFIIIESW
CILSSDKKNRGLIFSIYLFVYYGTQALSQLMINVHFSNGLLAYCFISSLCSIAIVLMAFT
KTVAPVPHSEEIYSPAKIIKKVPLAMVASVIGGSLLGSIYTLLPIFLVRVGSDHDMISVL
MMTTILGGMLLQVPIGKLSDLIDRRKVIFLAGAGIFITSIFIFAFHTSYFLFAIIMFIFG
GSAFVIYPLSISHASDFLNENEILGAIGVLTIAYGLGSVISPVVISGVMSVFGPFGFFII
TALLSISLCLYSAYRISVRKSATDRATFTIATPESLNFTEAQEIISEKSSEE
//