[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD31231.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------1-2----1--------------------------------------------111111111----1111111-111------------------------------------------------------------------------- --------------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKKNILFLILIVVVITASFLLGKKSGFNKAESIHESELRILEQSKLSQTPEDSLNCRPE:Sequence : :Sec Str : XXXXXXXXXXX :SEG|6->16|ilflilivvvi 61: . . . * . .: 120 :VNPNKDNYVIGYGSLMNKDSRQITVPNATYAAPILVSGFERLWASRGEKSRATFLLAVPN:Sequence : cEEEEEEccGGGcHHHHHHHcTTcEEEEEEEEEEEEEEEEEETTcccTTEEEEEEE:Sec Str : ======================================================:RP:SCP|67->187|1vkbA|1e-09|15.4|117/147|d.269.1.1 121: . . + . . .: 180 :KGYAMNAIYYKADAKDISATDLREASYCRVKIPRKDIVPLGIKSLPKGDFWMYVKDFKDA:Sequence :EEEEEEEEEEEEEGGGHHHHHHHTTGGGTccEEEETTEEEEETTccEEEEEEEEcccEEE:Sec Str :============================================================:RP:SCP|67->187|1vkbA|1e-09|15.4|117/147|d.269.1.1 181: . * . . . .: 240 :EFPNKDYPILQTYADTFMTGCLQTQAEFNLTEFGKLCFDTTYNWDLANWLYDRSNPRYSR:Sequence :ccccHHH HHHHHHHHccEEEEEcccHHHHHHHHHHHHHHTT :Sec Str :======= :RP:SCP|67->187|1vkbA|1e-09|15.4|117/147|d.269.1.1 241: + . . . . *: 300 :YSQDTEKYRPQIDKIIRRLTFDDDPL :Sequence : TccccccccccTTE :Sec Str