[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD31468.1"

            "peptidase U32 family"
            ""

OrgPattern --------------------------------332111111111111113332--------------- --1--------------------------------------------------------------------11111111222-1111122221222--1-121---1------------------11111111111111-----1----1---111111111-1--11111------------111------32222222222222222-222222222221--222222211222222222222222222222----------------------222222222222222222222221222221222222212211122222223222222222222222222222222-222133222321212222-221-11--1-------1----11111111111111111---------1----11---1---11----1--11111-----------1----111----------------------------------1----1------11111---1111111---1121112212-23321-3-11-2212133111111111-43322324222112222-222222222----11-311111111111111111111111111132312132-123333334433333345354--1-111------33223313333333332-3333333323333333333333221123333333333333333222322231-222222222222---2---------1-2-11111111111-1111111111---12-22222222222223111111111111123332222233322--------------112211------------2-1-----------1------1--------1--------12 ------------------------------------------------------------------------------------------------------------2------------------------------------------------------1-------------117111-1--------1----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRPELLSPAGTLKAMRYAFAYGADAVYIGQPRYSLRARNNEFSKLEILETATTEAHAQG:Sequence : cHHHHHHHHHHHHHHTcccEEEEcccccHHHHHHTTccHHHHHHHHHHHHHHc:Sec Str : =====================================================:RP:SCP|8->137|3be7A2|8e-06|23.3|129/303|c.1.9.18 :============================================================:BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453 61: . . . * . .: 120 :KKIMLANNIAPHNAKIKTYIKDITPVIALKPDAMIMSDPGMIMLVREHFPDQEIHLSVQA:Sequence :ccccEEEEEcHHHHHTTcHHHHHHHHHHHTccEEEETTccGGGcHHHHHHHHHccEEcTT:Sec Str :============================================================:RP:SCP|8->137|3be7A2|8e-06|23.3|129/303|c.1.9.18 :============================================================:BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|83->332|PF01136|9e-64|55.5|218/231|Peptidase_U32 121: . . + . . .: 180 :NAVNYETVRFWQKFGIKRVVLSRELSLKEIAEIKENVPDMEIETFVHGSLCMAYSGRCLL:Sequence :ccHHHHHHHHHHccccEEEEccccccccHHHHHHHTTccEEEEccccccHH :Sec Str : ##################:PROS|163->181|PS01276|PEPTIDASE_U32|PDOC00982| :================= :RP:SCP|8->137|3be7A2|8e-06|23.3|129/303|c.1.9.18 :============================================================:BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|83->332|PF01136|9e-64|55.5|218/231|Peptidase_U32 181: . * . . . .: 240 :SGYYSHRDPNQGVCNNACRNNYKVAEAKQNEWGDFEPIQTQSTLGIGTPSDKVVLIENDK:Sequence : :Sec Str :# :PROS|163->181|PS01276|PEPTIDASE_U32|PDOC00982| :============================================================:BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|83->332|PF01136|9e-64|55.5|218/231|Peptidase_U32 241: + . . . . *: 300 :EPGQYNPMFEDEHGTYIMNSKDLRAIQHVETMMKMGVDCFKIEGRTKSFFYAARTAQLYD:Sequence : :Sec Str :============================================================:BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|83->332|PF01136|9e-64|55.5|218/231|Peptidase_U32 301: . . . . + .: 360 :QAIKDALAGKPFDMTLMDKLEGLAHRGYTEGFYRRHVHDEYQKYDNSDSRSSTQQFVGEI:Sequence : :Sec Str :============================================================:BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|83->332|PF01136|9e-64|55.5|218/231|Peptidase_U32 361: . . . * . .: 420 :TNFDAHTGYADVNVRNKIKIGDSIELMLPSGSREIILDNMQDKDGKHMEEAKGSGYQAKI:Sequence : :Sec Str :============================================================:BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453 421: . . + . . .: 480 :KFDNVTAEDMKFALMIKNKSPNI :Sequence : :Sec Str :==================== :BL:SWS|1->440|YEGQ_ECOLI|e-148|60.6|436/453