[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ACD31488.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122221222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKTILKIFLTYKQYWKILNMQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTS:Sequence : XXXXXXXXXXXX :SEG|23->34|inninknislnn 61: . . . * . .: 120 :SPTILDIYDNKETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYI:Sequence : XXXXXXXXXXXXXX:SEG|107->121|ilgyglkvllklyil 121: . . + . . .: 180 :LDTKALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVV:Sequence :X :SEG|107->121|ilgyglkvllklyil 181: . * . . . .: 240 :GDSYVGKSFLGAYIPSYVYIINIKIYLISKNQYVINKIKTQIKKIEEKITNLPFKIELEI:Sequence : XXXXXXXXXXXXXXXXX :SEG|215->231|inkiktqikkieekitn 241: + . . . . *: 300 :SIENNKKNQIYLGYFNL :Sequence