[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD31488.1 ftul2 ACD31488.1 "conserved hypothetical protein"
MKTILKIFLTYKQYWKILNMQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTS
SPTILDIYDNKETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYI
LDTKALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVV
GDSYVGKSFLGAYIPSYVYIINIKIYLISKNQYVINKIKTQIKKIEEKITNLPFKIELEI
SIENNKKNQIYLGYFNL
//