[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:capB"

capB        "capsule biosynthesis protein CapB"
            ""

OrgPattern ----------------------------1-2------------------------------------- ------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11----1-------1111-------1--------------------------1111-------------------------------------------------------------------------------------------------------11-------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------11--11------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTLDFWLIVVVFVILCVYLIIENIVHNNSIKSIPIRIHVNGTRGKSSVARLIAAGVRAG:Sequence : cccccEEEEEEcccccccHHHHHHHHTTTc:Sec Str : =======================:RP:SCP|38->161|1e8cA3|6e-11|23.5|115/234|c.72.2.1 : ======================================================:BL:SWS|7->393|CAPB_BACAN|1e-58|36.8|378/464 61: . . . * . .: 120 :GYRTVAKTTGTLARYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAKADAIVIECMALQP:Sequence :cEEEccccccEETTcccETTEEccccccccTTcccTTHHHHHHTcTTccEEEEEccccTT:Sec Str :============================================================:RP:SCP|38->161|1e8cA3|6e-11|23.5|115/234|c.72.2.1 :============================================================:BL:SWS|7->393|CAPB_BACAN|1e-58|36.8|378/464 121: . . + . . .: 180 :LLQSLCELKLIKATHGVLTNARPDHLDVMGPTERDVAKALAATVPIGAKYFTAEDIHLDF:Sequence :HHHHHHTTHHHcccEEEEccccccccTTccccHHHHHHHHGGGTTcTTcEEEEEcGGGGG:Sec Str :========================================= :RP:SCP|38->161|1e8cA3|6e-11|23.5|115/234|c.72.2.1 :============================================================:BL:SWS|7->393|CAPB_BACAN|1e-58|36.8|378/464 181: . * . . . .: 240 :FEYACKDRGSELIAATAQDAEKISDEEINKFVYSEFKINVALALKVTDDLGIPREIALKG:Sequence :cccccEEEEEcTTccccEEEEEEcccEEEEccccHHHHHHHHHHHHHHHTTccHHHHHHH:Sec Str :============================================================:BL:SWS|7->393|CAPB_BACAN|1e-58|36.8|378/464 241: + . . . . *: 300 :MWEATPDPGAMTEYNFNIKNAEINFANAFAANDPVSTKMLWDKLCAKYSGCDKKVLVVNC:Sequence :GGGcccccccccEEcTTcccTTTcEEEEEcccccHHHHHHHHHHTTcccccccEEEEEEE:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|255->272|nfniknaeinfanafaan :============================================================:BL:SWS|7->393|CAPB_BACAN|1e-58|36.8|378/464 301: . . . . + .: 360 :RDDREDRSKQMAEAALGWQKQDLIVLIGTGTEVFTSFYKKYAKSLNKPMTKVIVCEEMTP:Sequence :cccccTTHHHGGGccTHHTTccEEEEEEcTTHHHHHHHHHccTTcEEEEEccccccTHH :Sec Str :============================================================:BL:SWS|7->393|CAPB_BACAN|1e-58|36.8|378/464 361: . . . * . .: 420 :IQILEKTVDSNPANSYILVGVGNIKDIGMELVDYCDTSHKKKHNL :Sequence : HHHHHHHHHccTTEEEEEccTTcEEETTEEEEccHHHHHHH :Sec Str :================================= :BL:SWS|7->393|CAPB_BACAN|1e-58|36.8|378/464