[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30942.1 ftul2 capB "capsule biosynthesis protein CapB"
MTTLDFWLIVVVFVILCVYLIIENIVHNNSIKSIPIRIHVNGTRGKSSVARLIAAGVRAG
GYRTVAKTTGTLARYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAKADAIVIECMALQP
LLQSLCELKLIKATHGVLTNARPDHLDVMGPTERDVAKALAATVPIGAKYFTAEDIHLDF
FEYACKDRGSELIAATAQDAEKISDEEINKFVYSEFKINVALALKVTDDLGIPREIALKG
MWEATPDPGAMTEYNFNIKNAEINFANAFAANDPVSTKMLWDKLCAKYSGCDKKVLVVNC
RDDREDRSKQMAEAALGWQKQDLIVLIGTGTEVFTSFYKKYAKSLNKPMTKVIVCEEMTP
IQILEKTVDSNPANSYILVGVGNIKDIGMELVDYCDTSHKKKHNL
//