[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:deoD"

deoD        "purine nucleoside phosphorylase"
            ""

OrgPattern ---1---1------------------------------------------------------------ ------1-----1----------------------------------1-------1----111---------------1---1----------------1---1-------------------------------------------------------------------------------111-----1111111111111111111-111111111111111111111-122222222222222111111-1-11-------11111-----1111111---1111111111111111111111111111111111111-1--2-------2-21---111111111-1-------------111--11----------------------------------------------1-------------------11-----111-----------------------------------------------------------------------------------------------------------1------------------------------------------1--------------1-1111111-------221---11-111112111321121333253--1----11-11111111111111111111-111111111111111111111111111111111111111111111111111--111111111111---------------11-111111111111111-----------------------------111111111-13322222222222-----------------1--------------111----1-2111311111111111111------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLLPTPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGKK:Sequence :HHHHccccccccHHHHccEEEEEccTHHHHHHHHTTcEEEEEEEEETTEEEEEEEETTEE:Sec Str : XXXX:SEG|57->74|kgkkvsvmgsgmgmpsmg : ========================================================:RP:SCP|5->237|1a69A|3e-52|32.5|231/237|c.56.2.1 : ============================================:BL:SWS|17->237|DEOD_CLOB8|1e-39|40.0|220/237 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->221|PF01048|7e-04|25.6|199/229|PNP_UDP_1 61: . . . * . .: 120 :VSVMGSGMGMPSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFI:Sequence :EEEEcccccHHHHHHHHHHHHHTTTccEEEEEEEEccccTTccTTcEEEEEEEEEEEccG:Sec Str :XXXXXXXXXXXXXX :SEG|57->74|kgkkvsvmgsgmgmpsmg : ################ :PROS|65->80|PS01232|PNP_UDP_1|PDOC00946| :============================================================:RP:SCP|5->237|1a69A|3e-52|32.5|231/237|c.56.2.1 :============================================================:BL:SWS|17->237|DEOD_CLOB8|1e-39|40.0|220/237 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->221|PF01048|7e-04|25.6|199/229|PNP_UDP_1 121: . . + . . .: 180 :EIVTGSKTSDVRSSEELNKELIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNC:Sequence :GGGTccTTccEEccHHHHHHHHHHHHHTTccEEEEEEEEEccccGGGTcccccccGGGTT:Sec Str :============================================================:RP:SCP|5->237|1a69A|3e-52|32.5|231/237|c.56.2.1 :============================================================:BL:SWS|17->237|DEOD_CLOB8|1e-39|40.0|220/237 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->221|PF01048|7e-04|25.6|199/229|PNP_UDP_1 181: . * . . . .: 240 :DLVEMETAALFATAAELGKKASAVVTISDSFITGESTTAQQREQSFTNMMEVALGTIKEN:Sequence :HHEEccHHHHHHHHHTTTcEEEEEEEEEEEcccTTTccHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|186->197|etaalfataael :========================================================= :RP:SCP|5->237|1a69A|3e-52|32.5|231/237|c.56.2.1 :========================================================= :BL:SWS|17->237|DEOD_CLOB8|1e-39|40.0|220/237 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|21->221|PF01048|7e-04|25.6|199/229|PNP_UDP_1