[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:folE"

folE        "GTP cyclohydrolase I"
            ""

OrgPattern ---1-11111111111-1-11-1-1-----------------------------------------11 1111211111111111111-1111211111121111213321211111111111111111113111211111---111111211111111111111---11122413111--------------1111111111111111111111322122211111111112111221211211111111111111--12111111111111111111111111111111---11111111--------------------1--1--11-1-1111--1--1--111111111111111111111111111111111111111111-1111-1-111111111-1-111111111-1-111-11221111--11111--11111211311111121221121111211111111111111111311111111111112111111111----------11111111111112121111111111--1111111111111----1131111----1111212111122111111-11211111-1---111111111111112---1----------111-1---------------------------1---1111111111111111111111111--1111113-11-11111121111111121111--11-11-----11111111111111111-1111111111111111111111111211111111111111111111111111111111111111111111111111111-11111111111111-11111111111111122222322221222222111111111-1111111111121111111111111111----111111-----------------------------------------------1- 11--11--1---1112211121121221111111-12111111-1-1111111211221111111111111111111-1111111111-1112111111111111--111314331-1---1111--21484-3121-11111-111-111111-11222211111-32151111111-C111-1-1221211121111 -------------------1-----------------------------------------------------------------------------------------------------1-----------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMMKDKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFE:Sequence : cHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHHHTTcTcTTGG:Sec Str : ====================================================:RP:SCP|9->204|1a8rA|5e-60|43.6|195/221|d.96.1.1 : ====================================================:BL:SWS|9->204|GCH1_VIBHB|5e-43|46.7|195/217 61: . . . * . .: 120 :KTPFRVARMFTQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGT:Sequence :GHHHHHHHHHHHTTTGGGcGGGcccccEEEcTTcccccEEEEEEEEEEEETTTccEEEEE:Sec Str : ################# :PROS|97->113|PS00859|GTP_CYCLOHYDROL_1_1|PDOC00672| :============================================================:RP:SCP|9->204|1a8rA|5e-60|43.6|195/221|d.96.1.1 :============================================================:BL:SWS|9->204|GCH1_VIBHB|5e-43|46.7|195/217 : $$$$$:RP:PFM|116->202|PF01227|8e-17|43.0|86/86|GTP_cyclohydroI 121: . . + . . .: 180 :AEVSFIPKNNNIIGLCRINSICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKH:Sequence :EEEEEccEccEEEcHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHTcccEEEEEEEEE:Sec Str : ########### :PROS|146->156|PS00860|GTP_CYCLOHYDROL_1_2|PDOC00672| :============================================================:RP:SCP|9->204|1a8rA|5e-60|43.6|195/221|d.96.1.1 :============================================================:BL:SWS|9->204|GCH1_VIBHB|5e-43|46.7|195/217 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->202|PF01227|8e-17|43.0|86/86|GTP_cyclohydroI 181: . * . . . .: 240 :ACVSLRGVNNQNSQTYTQMVGGVFAK :Sequence :HHHHccTTccccccEEEEEEcTHH :Sec Str :======================== :RP:SCP|9->204|1a8rA|5e-60|43.6|195/221|d.96.1.1 :======================== :BL:SWS|9->204|GCH1_VIBHB|5e-43|46.7|195/217 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|116->202|PF01227|8e-17|43.0|86/86|GTP_cyclohydroI