[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:galU"

galU        "UTP-glucose-1-phosphate uridylyltransferase"
            ""

OrgPattern --1-1-3344443423211-11-153433323233213232322121645553134232231121--- 2121422333311222222-2222132222212222222121221111-2223431111121--22221111111-112121-13132431211-----11221122211--------------1222214222231111211-111112111--22-22-12-123332312121111121232211211113121222212321122342224223122-3221112111611111111111111131112221124122221211221213222222222333222122122122123333333323333221222222212-34222232322412223342112-121-122243211321221111211-122111111221213122111111111111112-11312222231233332322233322112122222222-3333333311111212-----------------------------1111112111243323433333334544443335532222223222222222122121211222223333232322221214131222111211221121122121--1212111112111211111111111322222222222122322224333223231232--12212------33323344333443443-34433333433434444433333222342333433333434333444444221322222222222--1-2222211111221221121121111111111111122212222222131322211211222221222152221111113113221111111111111121111111111111111-1------1-111-1---1211-----1122321121121 -------------1------------------------------------1------------1--11--21-1-111111---------------1--1---------32-----------------------------------------------1111-311-2124------------11---1-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK:Sequence :ccccEEEEEcccccGGGTTGGGcccGGGcEETTEEHHHHHHHHHHHTTccEEEEEEcGGG:Sec Str : =========================================================:RP:SCP|4->279|1fxoA|1e-50|27.5|244/292|c.68.1.6 : ========================================================:BL:SWS|5->286|GALU_HAEIN|9e-69|50.0|280/295 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->252|PF00483|1e-30|40.2|219/238|NTP_transferase 61: . . . * . .: 120 :KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL:Sequence :HHHHHHHcccHHHHHTTcHHHccHHHHHHHTcccTTcEEEEEEcTTcccHHHHHHTTHHH:Sec Str :============================================================:RP:SCP|4->279|1fxoA|1e-50|27.5|244/292|c.68.1.6 :============================================================:BL:SWS|5->286|GALU_HAEIN|9e-69|50.0|280/295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->252|PF00483|1e-30|40.2|219/238|NTP_transferase 121: . . + . . .: 180 :VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKD:Sequence :HccccEEEEcTTEEETTccTTTcTHHHHHHHHHHHcccEEEEEEEcEEccGGGcccEEcT:Sec Str :============================================================:RP:SCP|4->279|1fxoA|1e-50|27.5|244/292|c.68.1.6 :============================================================:BL:SWS|5->286|GALU_HAEIN|9e-69|50.0|280/295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->252|PF00483|1e-30|40.2|219/238|NTP_transferase 181: . * . . . .: 240 :NDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ:Sequence :TcccEEEcEEccccTTccccEEEEEEEEEcTTHHHHHHHccccGGGcccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|4->279|1fxoA|1e-50|27.5|244/292|c.68.1.6 :============================================================:BL:SWS|5->286|GALU_HAEIN|9e-69|50.0|280/295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->252|PF00483|1e-30|40.2|219/238|NTP_transferase 241: + . . . . *: 300 :DEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFKEYLQNR :Sequence :HccEEEEEccccEEETTcHHHHHHHHHHHHHTcTTTHHHHHHHHHHH :Sec Str :======================================= :RP:SCP|4->279|1fxoA|1e-50|27.5|244/292|c.68.1.6 :============================================== :BL:SWS|5->286|GALU_HAEIN|9e-69|50.0|280/295 :$$$$$$$$$$$$ :RP:PFM|6->252|PF00483|1e-30|40.2|219/238|NTP_transferase