[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:glgB"

glgB        "1,4-alpha-glucan branching enzyme"
GLGB_FRATM  "RecName: Full=1,4-alpha-glucan-branching enzyme;         EC=2.4.1.18;AltName: Full=Glycogen-branching enzyme;         Short=BE;AltName: Full=1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase;"

OrgPattern -------222222222------------------------------1---11---------1------ 123-211333333-12322-22--2322222233332222322332311321222231----212--432122222221--1311---33221111---311-1131631211111111211112---------1-333-----111573442222211111112123354111111111111333------3-333332332333333-222-2333123-2-4-------22--------------------2--11-----11--11-1-----12222231231122222222222-1-----------334---333221-13-------3-2112214342-142-22--11111-32-1---2-2-114----------223322222222------------32323222312-1224432433332-1---1123222--22222222122-3244-------------------------------1----2122222-22213332233222221223222---2221-2---1-23---32212---------123231-111-312122111-423-111-2-2214413-----------------------1122112311--2-421111-1-111111-11-----2112------13111111111111111-111111111111111111111111---221223222222222211111111--111111111111-------------2---1121122-22121222----------21222232222333332222111111111111211111221223-55555555------3---------------1-2----------1--1111---------232212112241 --12112----111311-1111111111111111111111111111-1111111111-1111111111-1111-111-11111111---12111111112111112-11-21412221-1-11111-1-381-11111111-111111112-11111116CF11111112-12111443*323225453144------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSIC:Sequence : TTcccEEEETccccEEcccccGGGcccTTTcccccccTTcTTGGcEEEEEEEETTcccE:Sec Str : ================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|34->117|PF02922|9e-10|42.1|76/82|CBM_48 61: . . . * . .: 120 :VIGDFNYWQVEDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFF:Sequence :EEEETTTTEEEEEEcEEEEEcEEEEEEEEccccccEEEEEEEEETTEEEEEEETTEEEcc:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|34->117|PF02922|9e-10|42.1|76/82|CBM_48 121: . . + . . .: 180 :SELRPNTASIITTETQYTWSDDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDE:Sequence :ccccccEEEcTTccccHHHHHccEEEEcGGGTccccGGGcccTTccEETTEEcEcccHHH:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 181: . * . . . .: 240 :LNETLPQYIKEMGYTHVEFMPLHEHPLDASWGYQPTGFYSVNSRHGDIIGLKRLVDKLHN:Sequence :HHHTHHHHHTTTcccEEEEcccEEccccccccccccEEEEEcTTTccHHHHHHHHHHHHc:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|188->323|PF00128|4e-13|32.8|134/296|Alpha-amylase 241: + . . . . *: 300 :NDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAINKGWGTHNFDLGRNEVKCFLI:Sequence :cTTccccEEEEEEccTTcTTTcTTcccccccTTTcTTcTTGGGccEEETTTEEcEETTEE:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|188->323|PF00128|4e-13|32.8|134/296|Alpha-amylase 301: . . . . + .: 360 :SNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIAFLKELNGVLK:Sequence :EEEcccccTcTTcHHHHHHcTTTcccEEEETTTTTcccTTcccccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|188->323|PF00128|4e-13|32.8|134/296|Alpha-amylase 361: . . . * . .: 420 :HTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI:Sequence :HHcTTcEEEEccccccGTTTHGGTTTcccccEEccTTTTHHHHHHHHTcccTTccccccc:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 421: . . + . . .: 480 :TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIF:Sequence :HHHHHHHHHTTccHHHHHHcEEEcccTTcccHHHHTTTcHHHHHHHHHHHTTcccEEEEE:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 481: . * . . . .: 540 :MGSEFVQFVEWREYEQLQWQVVDQYESHKQTLHFFKKLNDLYHNETALWQCDYDHHGFRW:Sequence :TTGGGTcccccTTTTcccccTGGGccTTcHHHHHHHHHHHHHHHcHHHHHcEEGHHcEEE:Sec Str :============================================================:RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 541: + . . . . *: 600 :IDADNSQQSILSFIRSSKDNKQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFG:Sequence :EEEEETTTTEEEEEEEcccTccEEEEEEEcccEEEcGGGGTccTTcEEEETTTccEEEcc:Sec Str :================================= :RP:SCP|45->573|2fhbA5|8e-61|10.9|506/563|c.1.8.1 :============================================================:BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|543->640|PF02806|2e-16|43.3|90/95|Alpha-amylase_C 601: . . . . + .: 660 :GSGQVMATEIFSSPQSSHGFEQRITIKIPPMATLVLKLIK :Sequence :TTcEEEEEccccccETccEEEccEEEEEcTTcEEEEEccc :Sec Str :======================================== :BL:SWS|1->640|GLGB_FRATM|0.0|100.0|640/640 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|543->640|PF02806|2e-16|43.3|90/95|Alpha-amylase_C