[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30570.1 ftul2 glgB "1,4-alpha-glucan branching enzyme"
MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSIC
VIGDFNYWQVEDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFF
SELRPNTASIITTETQYTWSDDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDE
LNETLPQYIKEMGYTHVEFMPLHEHPLDASWGYQPTGFYSVNSRHGDIIGLKRLVDKLHN
NDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAINKGWGTHNFDLGRNEVKCFLI
SNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIAFLKELNGVLK
HTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIF
MGSEFVQFVEWREYEQLQWQVVDQYESHKQTLHFFKKLNDLYHNETALWQCDYDHHGFRW
IDADNSQQSILSFIRSSKDNKQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFG
GSGQVMATEIFSSPQSSHGFEQRITIKIPPMATLVLKLIK
//