[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:gltB"

gltB        "glutamate synthase domain 2"
            ""

OrgPattern ---1--1111111111-11111111--111112131112111112-21111111-1-----1------ 11113--111111121111-13112311111234442476122211-11111121221--112111231211111111----111111--1111-----1-213222212---------------2112231123211111111112121112111111111112111111111111111111111111--122222222221222222111122222211-31211111132-2222222222222222122----11---------11----1-111--------11----------------------------------11-11-------1-1-111------1--1111111111-2-111112---2111111-----132222122222211111111111-11111111112-1111111111112221223111112221111111121111211-----------------------------4213112222222222222222222322222222211111222222111211221222111111-------11211111213211111222-1211222321111111-1--1-11111----------2111311111222422222233312322223233223---3222------1111111111111-111-1111111111111111111111111111111--1---11111121111111--111111111111---111111111112222-----------1---222421312222222232233343312221-111111-21112222222332222111111111111111-221222--------------------------------------1--1-111111 11----1-1---11111111111-1111111111111111-11111111111111111111111-111-11-11111-1111111111-12111111111121212-12-2---------------------------------------------------121112113112-1222V1111262151442242112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHISERRKWYIGFAVFVMVILLSLSLLHASIWFSIGFVAVLAVIAIYDVSQTKHSILRNF:Sequence : :Sec Str : XXXXXXX :SEG|21->27|llslsll 61: . . . * . .: 120 :PIVGHMRYILEFLRPEIQQYFIADNESEKPFGRELRSTIYRRAKGINDTVAFGTEKDIYR:Sequence : ccTTcccccccccccccccHTTccHHHHHHHHccccHHHHHHHH:Sec Str 121: . . + . . .: 180 :VGYEWVTHSLMPKHLDEIETRVKIGGSDCKQPYMASHLNISAMSFGALSANAVMALNKGA:Sequence :GGGGEEEccccccccccccccEEETTEEEcccEEcccEEEcccccGGGTcTTHHHHHHHH:Sec Str : =============================================:RP:SCP|136->477|1ea0A2|7e-53|29.1|323/763|c.1.4.1 : =====================:BL:SWS|160->491|GLUS_METJA|4e-39|34.0|315/510 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|154->472|PF01645|4e-53|41.3|300/342|Glu_synthase 181: . * . . . .: 240 :KLGGFYQCTGEGGLTKYHLQGGDLVFQIGTGYFGCRTDDGKFSAEKFVEKANLDSVKMIE:Sequence :HHHHHHHHEEEEcTTTccEEEEEEEEEcccTTTccHHHHHHHHHTTEEccTTccHHHHHH:Sec Str :============================================================:RP:SCP|136->477|1ea0A2|7e-53|29.1|323/763|c.1.4.1 :============================================================:BL:SWS|160->491|GLUS_METJA|4e-39|34.0|315/510 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|154->472|PF01645|4e-53|41.3|300/342|Glu_synthase 241: + . . . . *: 300 :IKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPPAHSAFSTPIEFCYFIKQLRD:Sequence :HHHTTccccccccccTTTccccccTTccccHHcTTccEEEEcGGGccHHHHHHHHHHccG:Sec Str :============================================================:RP:SCP|136->477|1ea0A2|7e-53|29.1|323/763|c.1.4.1 :============================================================:BL:SWS|160->491|GLUS_METJA|4e-39|34.0|315/510 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|154->472|PF01645|4e-53|41.3|300/342|Glu_synthase 301: . . . . + .: 360 :LSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVDGADGGTGAAPLEFSNHIGMPL:Sequence :HcTTGGHHHHHHHHHHHHHHHHHHccTTTccccccccTTcccccTTccccccGGTcEEEE:Sec Str : XXXXXXXXXX :SEG|339->348|dgadggtgaa :============================================================:RP:SCP|136->477|1ea0A2|7e-53|29.1|323/763|c.1.4.1 :============================================================:BL:SWS|160->491|GLUS_METJA|4e-39|34.0|315/510 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|154->472|PF01645|4e-53|41.3|300/342|Glu_synthase 361: . . . * . .: 420 :EDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS:Sequence :EEEETTTTEEEEEEEEEcGGGGGGGTGGGTTcEEEcTEEEcGGEcccHHHHHHHHHHHGG:Sec Str :============================================================:RP:SCP|136->477|1ea0A2|7e-53|29.1|323/763|c.1.4.1 :============================================================:BL:SWS|160->491|GLUS_METJA|4e-39|34.0|315/510 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|154->472|PF01645|4e-53|41.3|300/342|Glu_synthase 421: . . + . . .: 480 :RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLISTDDVEP:Sequence :cEEEEEEccTTcGGGHHHHHHHHHGGGccccGGGEEEEEEEEcccEEEEEEEEHHHHHHH:Sec Str :========================================================= :RP:SCP|136->477|1ea0A2|7e-53|29.1|323/763|c.1.4.1 :============================================================:BL:SWS|160->491|GLUS_METJA|4e-39|34.0|315/510 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|154->472|PF01645|4e-53|41.3|300/342|Glu_synthase 481: . * . . . .: 540 :ENLKKRISVNEIKSYADLYDFIPERCLVDGNIPASFARSWEKARADSF :Sequence :HHHHHHTTccEccccccc :Sec Str :=========== :BL:SWS|160->491|GLUS_METJA|4e-39|34.0|315/510