[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30613.1 ftul2 gltB "glutamate synthase domain 2"
MHISERRKWYIGFAVFVMVILLSLSLLHASIWFSIGFVAVLAVIAIYDVSQTKHSILRNF
PIVGHMRYILEFLRPEIQQYFIADNESEKPFGRELRSTIYRRAKGINDTVAFGTEKDIYR
VGYEWVTHSLMPKHLDEIETRVKIGGSDCKQPYMASHLNISAMSFGALSANAVMALNKGA
KLGGFYQCTGEGGLTKYHLQGGDLVFQIGTGYFGCRTDDGKFSAEKFVEKANLDSVKMIE
IKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPPAHSAFSTPIEFCYFIKQLRD
LSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVDGADGGTGAAPLEFSNHIGMPL
EDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS
RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLISTDDVEP
ENLKKRISVNEIKSYADLYDFIPERCLVDGNIPASFARSWEKARADSF
//