[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:hfq"

hfq         "host factor I for bacteriophage Q beta replication"
HFQ_FRATM   "RecName: Full=Protein hfq;"

OrgPattern -------------------------------------------------------------------- 111--------------------------------------------------------------------------------11121-------------------------------------------------------------------------------------------------------111111111111111111111111111111-11111111111------------------------------------------------------------------------------------------11111111111111111111111--1--1--1111211111111111------111111111111111111111111111111111-11111111111-12-1111111111111111111111111111111111111111------------------------------1111111111222222222222222212222222111111111111111111111111111111111111111111----------------1--11111---------------------------------111121111111111111111111111111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111-111-----1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1-111111------------------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRISSLQDPFLNALRKEKVNVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAIS:Sequence : TTHHHHHHHHHHHTcEEEEEETTccEEEEEEEEEcTTcEEEEEEEEccEEEEEEE:Sec Str : =======================================================:RP:SCP|6->68|1hk9A|2e-24|77.8|63/64|b.38.1.2 :============================================================:BL:SWS|1->109|HFQ_FRATM|5e-60|100.0|109/109 61: . . . * . .: 120 :TIVPAKSVRMVYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE :Sequence :EEEcGGGEEEE :Sec Str :======== :RP:SCP|6->68|1hk9A|2e-24|77.8|63/64|b.38.1.2 :================================================= :BL:SWS|1->109|HFQ_FRATM|5e-60|100.0|109/109