[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:hslU"

hslU        "ATP-dependent protease HslVU, ATPase subunit"
HSLU_FRATW  "RecName: Full=ATP-dependent hsl protease ATP-binding subunit hslU;"

OrgPattern -------------------------------------------------------------------- 2221111111111111111-111111111111111111111111111111111111111111111121111111111111111222221111111121-11111112211111111111111111222222222221-111---1211111111111111111111111111111111111111112211-22222222232222222222222222222222222222222222222222222222222222222212212222211222221111111111111111111111111111111111111111111111111121111111111111111111111211111222222222222222222111221222222222222222222222222122222222-2222222222222222222222222222222222222222222222222212222222222222211222222222222222222222222222222222222222222222222222222221122222222211222223211122111111122222313332222222222211111112144344123221222222222222222222322222222222222222222222222222222222212233222222222222232222222222-22222222222222222222222222222222222222222222222222222222222222222112222222222242222222222222212222111111111132222222222222232222222222222122222222222222222222222212211232222222222222221--------------------------2222222222211 11--111-522-11111--11111-11111111---1111111-1111---1-1---111111---11--11-1-11-111-----------1-1-1111-11222-14212111221-11-1122111171-11111112-111111-11112-211113221-2-211B82132332G322116333-322244332 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPT:Sequence : ========================================================:RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :============================================================:BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455 : $$$$$$$$$$:RP:PFM|51->105,260->340|PF07724|6e-10|56.5|120/160|AAA_2 61: . . . * . .: 120 :GVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKV:Sequence : XXXXXXXXX:SEG|112->125|kreeakekvtekaa :============================================================:RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :============================================================:BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|51->105,260->340|PF07724|6e-10|56.5|120/160|AAA_2 121: . . + . . .: 180 :TEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGEL:Sequence :XXXXX :SEG|112->125|kreeakekvtekaa :============================================================:RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :============================================================:BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455 181: . * . . . .: 240 :DDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDE:Sequence : XXXXXXXXXXXXXXX :SEG|221->235|dkkknkkmrikdaik :============================================================:RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :============================================================:BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455 241: + . . . . *: 300 :EAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGS:Sequence :============================================================:RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :============================================================:BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|51->105,260->340|PF07724|6e-10|56.5|120/160|AAA_2 301: . . . . + .: 360 :TVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPD:Sequence :============================================================:RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :============================================================:BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|51->105,260->340|PF07724|6e-10|56.5|120/160|AAA_2 : $$$$$$$$$$$:RP:PFM|350->416|PF10431|3e-07|55.9|59/90|ClpB_D2-small 361: . . . * . .: 420 :CSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISF:Sequence :============================================================:RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :============================================================:BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|350->416|PF10431|3e-07|55.9|59/90|ClpB_D2-small 421: . . + . . .: 480 :DAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL :Sequence :=================================== :RP:SCP|5->455|1do0A|9e-46|59.4|404/406|c.37.1.20 :=================================== :BL:SWS|1->455|HSLU_FRATW|0.0|100.0|455/455