[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD31053.1 ftul2 hslU "ATP-dependent protease HslVU, ATPase subunit"
MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPT
GVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKV
TEKAARLAEDRILDVLIPPARTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGEL
DDKEIEIEVAVAPKTIGVMGPPGMEDMTSQLQDLFSSLSTDKKKNKKMRIKDAIKLAQDE
EAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGS
TVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIEDFVRILREPD
CSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISF
DAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL
//