[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:mraY"

mraY        "phospho-N-acetylmuramoyl-pentapeptide- transferase"
MRAY_FRATM  "RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;         EC=2.7.8.13;AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase;"

OrgPattern ---1----------------------------211-1---------------------1--------- 1121211111111111111-11111111111111111211111211112221111112111111111121111111112112111111111111111--111111121111111111111111111112121111222221---1111111111111111111111-111121111111111111111111111222221111212111212211121111-21111121122222222222222222222121212112112211111112111111111111111111111111111111111111111111221112221211213333333131211121111221111-121111111121111211111-1-1111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111--------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111211111111121221111112111111111112111111111111111111111111111111111112111111111111-11111-1-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1211111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------1111111111111 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1--1--1------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLIYLFEWLSHYFKGLEVFSSYISVRIIMISITSLLITLALGRPMISWLQKMQIGQIVRD:Sequence : XXXXXXXXXXXXXXX :SEG|27->41|iimisitsllitlal :============================================================:BL:SWS|1->365|MRAY_FRATM|0.0|100.0|365/365 61: . . . * . .: 120 :DGPQSHFSKRNTPTMGGVLILSSVIISCLLWGDLTSIYLWILILVVIFFGAIGFFDDYLK:Sequence : XXXXXXXXXXXXX :SEG|78->90|vlilssviiscll : ############# :PROS|69->81|PS01347|MRAY_1|PDOC01046| :============================================================:BL:SWS|1->365|MRAY_FRATM|0.0|100.0|365/365 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->289|PF00953|2e-24|48.1|162/162|Glycos_transf_4 121: . . + . . .: 180 :LVLKHPKGLRAKHKFALQSIFSIVLAIVLFYLLSKNGQMSLSIPFSKSLYIPMGIVIFVV:Sequence : XXXXXX:SEG|175->186|ivifvvlaffii :============================================================:BL:SWS|1->365|MRAY_FRATM|0.0|100.0|365/365 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->289|PF00953|2e-24|48.1|162/162|Glycos_transf_4 181: . * . . . .: 240 :LAFFIINGSSNAVNLTDGLDGLAIVPVVLVAAGLGIYAYIETNSTLANYLLFNYLGNPGL:Sequence :XXXXXX :SEG|175->186|ivifvvlaffii : ############ :PROS|191->202|PS01348|MRAY_2|PDOC01046| :============================================================:BL:SWS|1->365|MRAY_FRATM|0.0|100.0|365/365 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->289|PF00953|2e-24|48.1|162/162|Glycos_transf_4 241: + . . . . *: 300 :AEVAVFCAAVCGSGLAFLWFNSHPAEVFMGDVGSLTLGAVLGVIAVMVRQELIFFIMGLL:Sequence :============================================================:BL:SWS|1->365|MRAY_FRATM|0.0|100.0|365/365 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|99->289|PF00953|2e-24|48.1|162/162|Glycos_transf_4 301: . . . . + .: 360 :FVVEALSVMLQVGSYKLRNGKRIFRMAPIHHHFELKGWPETKVVIRFWIISLILFLIGLA:Sequence :============================================================:BL:SWS|1->365|MRAY_FRATM|0.0|100.0|365/365 361: . . . * . .: 420 :AIKVR :Sequence :===== :BL:SWS|1->365|MRAY_FRATM|0.0|100.0|365/365