[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:ompH"

ompH        "outer membrane protein OmpH"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------1--------------1------1-------------111111---------------------------------1111-----------------1-------1111111111111111------------1------------------------------1111---------1---111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKIALSICVLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQE:Sequence : ccccEEEEcHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHH:Sec Str : =======================================:RP:SCP|22->162|1sg2A|2e-13|23.9|138/141|f.48.1.1 : =======================================================:BL:SWS|6->162|SKP_BLOFL|3e-16|29.3|157/168 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->160|PF03938|9e-07|24.0|150/158|OmpH 61: . . . * . .: 120 :QDNIMQQMKTLQDNSATMTKSELDKKQQQIQQEQQNFAEKARILQQKEYTAKDKLSKKFQ:Sequence :HHHHHHHHHHHTTccccHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXX :SEG|87->95|qqqiqqeqq :============================================================:RP:SCP|22->162|1sg2A|2e-13|23.9|138/141|f.48.1.1 :============================================================:BL:SWS|6->162|SKP_BLOFL|3e-16|29.3|157/168 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->160|PF03938|9e-07|24.0|150/158|OmpH 121: . . + . . .: 180 :ASFDKAVQTIAKQKNYNVVLTTQALAYVNNVDDISSQVVELMNKDSE :Sequence :HHHHHHHHHHHHHTTccEEEEGGGccccTTccccHHHHHH :Sec Str :========================================== :RP:SCP|22->162|1sg2A|2e-13|23.9|138/141|f.48.1.1 :========================================== :BL:SWS|6->162|SKP_BLOFL|3e-16|29.3|157/168 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|11->160|PF03938|9e-07|24.0|150/158|OmpH