[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30379.1 ftul2 ompH "outer membrane protein OmpH"
MKKIALSICVLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQE
QDNIMQQMKTLQDNSATMTKSELDKKQQQIQQEQQNFAEKARILQQKEYTAKDKLSKKFQ
ASFDKAVQTIAKQKNYNVVLTTQALAYVNNVDDISSQVVELMNKDSE
//